DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nep6

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001245645.1 Gene:Nep6 FlyBaseID:FBgn0030425 Length:655 Species:Drosophila melanogaster

Alignment Length:724 Identity:142/725 (20%)
Similarity:247/725 (34%) Gaps:226/725 (31%)


  Fly   162 AVASSIQARLNWNKD----PCTEFKKFSC--WRNTPNKNI---------------TNLIEMGNSQ 205
            |.|...|.:|:.:.|    ||..|.:::|  |.:..::.|               ..||......
  Fly    23 AAAQDCQQQLDNDTDAEVKPCENFHQYACGNWYSNTSQRILGAHDMRSKWVANLKLQLIRYLEES 87

  Fly   206 KSVDSQMLYLFQNKIMNGSFGILHNLFESCLQQ----TTNSTVMHR--------------IFDSL 252
            .|.||    ...|..:..|...|..|:..||..    .|.:..:.|              .||.:
  Fly    88 SSTDS----FSANTSVTTSTAQLGTLYRCCLLSGQSIRTYTDALSRSGANFPLLANHTGGSFDWV 148

  Fly   253 GGYLPVGSVGPSSIAPLIAK---------IYDLGPSPLVDL------YHDLSYGRRPHILLIISG 302
            .....:.:.|...:..|:.|         |:.:.| |..||      .::..|.|...|||:..|
  Fly   149 LANAALRTYGAQGLWRLLVKDNWQSADQRIFYMLP-PKFDLLGRDDELNEFLYQRYLKILLLELG 212

  Fly   303 PSTSSTIL--------ERKIRWMSPKAPPSRIRQGVPKLLADLIENFLP------YFVSYAQRVS 353
            .......|        |:.::.:.|......:....|:.|.|| |:.||      ||        
  Fly   213 LRVRRAALLAEKLVAFEKSLQKLLPNDAEQTLVLRKPQSLKDL-ESQLPRLELKRYF-------- 268

  Fly   354 EKDTIFEFIKDLNKLQVEHSRRGFWDSTVLYNVSSLQDLYPVLNWTLLIPQNWSGPIVVRNSDYL 418
              :||.|.|.              |||..|..|:.|..|..:..   |:.::.|.|:|:.....|
  Fly   269 --ETILEGID--------------WDSKTLLLVADLDYLQGLQR---LLAEHTSDPMVLSTWLLL 314

  Fly   419 KALEYFLTKYPTRVAHNSLLLLS----ALQILPRDYPSPEVCTRSTMWALPELSSSLYIAQHSSE 479
            :...||..:     .|:...|.:    .|:.|.:..|.          .|..|...|.:.: |.:
  Fly   315 QLPAYFELR-----LHDDDKLGNQRNHCLEQLRKLMPG----------QLGRLQMQLVLGE-SYQ 363

  Fly   480 DLKDTT-KRAEIIFKSLKAHLKRAPS----------LKGAALVKLSALKIQSQTWEGFSNTTDLL 533
            |:.||. ::..::|:.||...:...:          .:..|..||.|:::             |.
  Fly   364 DVYDTAIQQIAVLFRDLKQQFELVLNETEVFNEDLVTRNLARDKLRAMRL-------------LT 415

  Fly   534 KSLQ-PLN-------ITSECWFQNILEI-YKKNKLEPNDISLNGGSHDAWAYPIVS--------T 581
            ..|| |:|       :...| ..|:|:: ..:.|||...:         :..|:.|        .
  Fly   416 PRLQDPINGGPGTPQLGGNC-DANLLQLSLSQAKLEYRQV---------FGEPVTSVPADPLSVN 470

  Fly   582 IFYDTLSHSIVVPLSVILIPYF----------NAVLPPYLHYASVGVSIAKEILRSITKSFDEKA 636
            .:|....:.|.:||.::..|..          .|.|.     |.:|..:|.|::.    :||...
  Fly   471 AYYRLKLNRIELPLGLMATPLIQQQCSKEADTRAKLS-----AGLGYILAHEMVH----AFDLDG 526

  Fly   637 MRCVPHSVNIFSNYSRMDIL---IHSG---GMQISYHSMLSLTGPIKGMARLPGLNL-------- 687
            :............:|...|:   :.:|   |::.| ::.|::.   :.:|...||.|        
  Fly   527 LNYDATGQLANGQWSARAIIRFGLRAGCYLGVRYS-NATLTVN---ENIADTEGLRLALDTYRHR 587

  Fly   688 ---TPTQIFFLVSAQELCAE-------SNYLGIDTNAPEFDNILGWLVAQGGSATEVFKCPSGSM 742
               |..:.||:..||..|..       |.:.|   :|...:|::|.:...|    :.|:|.:.|.
  Fly   588 SGATNLRTFFVAFAQNWCGTVASTSGLSQHAG---HAERVNNVVGNMPEFG----DTFECKATSQ 645

  Fly   743 INVQKTCNV 751
            :|....|::
  Fly   646 MNPVNKCHI 654

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 137/707 (19%)
Nep6NP_001245645.1 PepO 35..655 CDD:226118 138/713 (19%)
M13 40..653 CDD:189000 137/705 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.