DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nep1

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001284925.1 Gene:Nep1 FlyBaseID:FBgn0029843 Length:849 Species:Drosophila melanogaster

Alignment Length:732 Identity:154/733 (21%)
Similarity:272/733 (37%) Gaps:191/733 (26%)


  Fly   155 CSDPICEAVASSIQARLNWNKDPCTEFKKFSCWRNTPNK---------NITNLIEMGNSQKSVDS 210
            |....|...|:|:.:.::.|.|||.:|.:::|  .|.||         :|:....:.:.|:.:..
  Fly   173 CMTQECVRTAASLLSAMDLNSDPCEDFFQYAC--GTWNKMHPIPEDRSSISTFEVLSDQQQVILR 235

  Fly   211 QMLYLFQNKIMNGSFGILHNLFESCLQ----QTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLIA 271
            .:|....::..|.:.......|:||:.    :...:..:.::..||||:            |:|.
  Fly   236 AVLEEPIDERDNKATIKAKTFFKSCMDIPQIRKIGTGRLKQVLQSLGGW------------PVIE 288

  Fly   272 KIYDLGPSPLVDLYHD-------LSYGRRPHILLIISGPSTSSTILERKIRWMS--PKAPPSRIR 327
            :.:    ||..||..:       |:|.....|.|.:.....:|::   .|..|.  ..|.|||  
  Fly   289 RNW----SPPADLSVERLMGQLRLNYSEPVMIELYVGADDKNSSV---NILQMDQLQYALPSR-- 344

  Fly   328 QGVPKLLADLIENFLPYFVSYAQRVS--------------EKDTIFEFIKDLNKLQVEHSRRGFW 378
               ...|.:...|....:..|..:|:              ||..:||  ..|..:.:..:.|  .
  Fly   345 ---DYYLKESSANDRRAYHRYMTQVALLLGADPATAAAELEKVVLFE--TQLVNVSLPEADR--H 402

  Fly   379 DSTVLYN---VSSLQDLYPVLNWTLL--------IPQNWSGPIVVRNSDYLKALEYFLTKYPTRV 432
            |::::|.   :..||:|.|.:.|...        ||.....|:|.....||..:...|.....||
  Fly   403 DTSLVYRKMLLPELQELVPEVQWQEYLQAALGPGIPLQEDEPLVTYGLHYLTEMGKILAHTDRRV 467

  Fly   433 AHNSL---LLLSALQILPRDYPSPEVCTRS---------TMWA---------LPELSSSLYIAQH 476
            .||.:   |::|.:..:..:|....|..|.         |.|:         |.....:|:|..:
  Fly   468 VHNYMLWRLVMSLMSHMIDEYQRERVEFRKILMGIQSERTRWSQCVEWTNKKLGVAVGALFIRDN 532

  Fly   477 SSEDLKDTTKRAEIIFKSLKAHLKRA-------------PSLKGAALVKLSALKIQSQTWEGFSN 528
            .:::.|:..  .|:|      |..||             ...:..|..|..::..:....|..:|
  Fly   533 FNQESKEVA--LEMI------HTIRAAFNELLAENDWMDDETRAVAKEKADSMNERIGYPELLTN 589

  Fly   529 TTDLLKSLQPLNITSECWFQNILEI--YKKNKL-----EPNDISLNGGSHDAW-AYPIVSTIFYD 585
            .|:|.:....|.|..:.:..|:|.|  ::..|:     :|.|       .:.| ..|.|...||:
  Fly   590 ATELEQEYVNLTIVPDNFINNVLSILQWESEKMLRLLRQPVD-------KEKWTTEPAVVNAFYN 647

  Fly   586 TLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSITKSFDEKA-------------- 636
            ...:.||.|..::...:::...|..|:|..:||.|..|    ||..||:|.              
  Fly   648 PNKNDIVFPAGILQPLFYSQHFPKSLNYGGIGVVIGHE----ITHGFDDKGRQFDKEGNMMQWWN 708

  Fly   637 ----------MRCVPHSVNIFSNYSRMDI-------------LIHSGGMQ---ISYHSMLSLTGP 675
                      .:||   ::.:|.|...::             :..:||::   .:|....:|.|.
  Fly   709 NATIEAFRERTQCV---IDQYSRYKINEVDMFMDGRMTQGENIADNGGLKQAFRAYKKWETLHGR 770

  Fly   676 IKGMARLPGLNLTPTQIFFLVSAQELCAES------NYLGIDTNAPEFDNILGWLVAQGGSATEV 734
            .:   :|||||:|..|:|||..||..|...      ..:....::|.|..:||.| :........
  Fly   771 EQ---QLPGLNMTHDQLFFLNYAQIWCGSMRPEDALTKIRSAVHSPGFVRVLGPL-SNSRDFASA 831

  Fly   735 FKCPSGSMINVQKTCNV 751
            :|||.||.:|..:.|:|
  Fly   832 YKCPLGSTMNPAEKCSV 848

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 147/708 (21%)
Nep1NP_001284925.1 M13 194..847 CDD:189000 148/709 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.