DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and frma

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_572226.2 Gene:frma FlyBaseID:FBgn0029769 Length:611 Species:Drosophila melanogaster

Alignment Length:682 Identity:126/683 (18%)
Similarity:220/683 (32%) Gaps:205/683 (30%)


  Fly   167 IQARLNWNKDPCTEFKKFSC--WRNTPNKNITNLIEMGNSQKSVDSQMLYLFQNKIMN------- 222
            :|.:.:...|||..|.|.:|  |         :.....:|.:|...::.|.:|.|:.:       
  Fly    17 VQVKSHPQADPCQNFYKVACGNW---------SASHATDSYESFMDRLDYNYQEKLADLLDNERE 72

  Fly   223 ----GSFGILHNLFESCLQQTTNSTVMHRIFDSL-------GGYLPVGSVGPSSIAPLIAKIYDL 276
                .....|.|.:.:|.:..:...|: ||.:.|       ...|.||......:..||    ||
  Fly    73 DDEPHFLQQLRNFYTACRKPLSQDQVL-RILEHLIVMENIQNEELSVGLTAAFRLQVLI----DL 132

  Fly   277 GPSPLVDLYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSRIRQGVPKLLADLIENF 341
            ..|...|::..| ...|.|     ..|:|::            :.|.:  |:...||.|.|.:..
  Fly   133 NDSNTYDIWKQL-MSHRKH-----WDPNTTN------------REPLT--REMFDKLWASLPKIP 177

  Fly   342 LPYFVSYAQRVSEKDTIFEFIKDLNKLQVEHSRRGFWDSTVLYNVSSLQDLYPVLNWTLLIPQNW 406
            .|:...|.:.:||.:         .|:....|....:||..|               ...||..|
  Fly   178 FPFKEYYWRELSELE---------EKIMSYGSEDDGFDSGDL---------------VTRIPPFW 218

  Fly   407 SGPIVVRNSDY-----------LKALEYFLTKYPTRVAHNSLLLLSALQI----LPRDY---PSP 453
            ..|....|..|           :||.|:.||....|:.    |:...:..    :.||.   .|.
  Fly   219 MMPWPNGNITYENLSQMAHWLDIKANEFILTYIYMRLK----LVAEGVSTESWHIDRDQCAEQSR 279

  Fly   454 EVCTRSTMWALPELSSSLYIAQHSSEDLKDTTKRAEIIFKSLKAHLKR-------------APSL 505
            ::.:....|          :.:.:...||:     |.:.:.:.|.||:             ..|.
  Fly   280 QILSHPAAW----------LVEKNHPRLKE-----EPVLQDIFAELKQRFGQKLLANRNNFTRST 329

  Fly   506 KGAALVKLSALKIQSQTWEGFSNTTDLLKSLQPLNITSECWFQNILEIYKKNKLEPND------I 564
            :...|.||..::::              .|:.|.|.:::...:.|...|:...:..:|      |
  Fly   330 QHFLLGKLKRMRLR--------------LSILPRNSSAQSMVRRIERHYRDVHMNASDYFGNLHI 380

  Fly   565 SLN-GGSH----DAWA------------------------YPIVSTIFYDTLSHSIVVPLSVILI 600
            .|| ..||    ..||                        |...::.||....:.::||||::..
  Fly   381 GLNHSRSHKKYAQLWAIVFGRQLIPSRISKSDLYPTQVRGYGTYASAFYIVKQNMLIVPLSLLEP 445

  Fly   601 PYFNAVLPPYLHYASVGVSIAKEILRSITKSFDEKAMRCVPHSVNIFS----------------- 648
            |::....|..|.|:::|..:..|    ::..||.:.|....|.|...:                 
  Fly   446 PFYTHGQPSILTYSALGFILGHE----LSHGFDSEGMTFSSHGVGSSAVDRELDRNPRFQQELGC 506

  Fly   649 -----NYSRMDILIHSGGMQISYHSMLSLTGPIKGMARLPGLNLTPTQIFFLVSAQELCAESNYL 708
                 ...|.:....:.|::::|.:............|.....:|..|.||...||..|::...|
  Fly   507 LRRRFGRKRYEKFADASGLELAYSAYFDTAQTDHKRNRSAEELVTQKQQFFHNFAQFFCSDKELL 571

  Fly   709 GIDTNAPEFDNILGWLVAQGGSATEVFKC-PS 739
            ....:..:...: ...||......|.|.| ||
  Fly   572 QAHDHGSDRKRV-NDAVAHFEPFREAFSCGPS 602

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 125/674 (19%)
frmaNP_572226.2 GluZincin 25..601 CDD:301352 123/672 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.