DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Mmel1

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001101467.1 Gene:Mmel1 RGDID:1309299 Length:775 Species:Rattus norvegicus

Alignment Length:852 Identity:183/853 (21%)
Similarity:309/853 (36%) Gaps:236/853 (28%)


  Fly    58 MGKSD-EIEMIDSANIENFNTRYNKNSIIGWICCAPCIWLRTSAAVHKMAITSATLLVTTLLVAS 121
            ||||: .:.|::.|  :|...|.     :|::.|...:.|              |||:...:|..
  Rat     1 MGKSESSVGMMERA--DNCGRRR-----LGFVECGLLVLL--------------TLLLMGAIVTL 44

  Fly   122 PILFLISTAPSPLP-----------------RDCYMDGDRCSPAVSAPPECSDPICEAVASSIQA 169
            .:.:.|.   ..||                 |....|..:.|..      |:.|.|...|:.|..
  Rat    45 GVFYSIG---KQLPLLNSLLHVSRHERTVVKRAALRDSSQKSDI------CTTPSCVIAAARILQ 100

  Fly   170 RLNWNKDPCTEFKKFSC--WRNTPNKNITNLIEMGNSQKSVDSQM---LYLFQNKIMNGSFGILH 229
            .::.:|.||..|.:::|  |..      .::|...||:.||...:   |.:....::..| .:.|
  Rat   101 NMDQSKKPCDNFYQYACGGWLR------HHVIPETNSRYSVFDILRDELEVILKGVLEDS-SVQH 158

  Fly   230 --------NLFESCLQQTT----NSTVMHRIFDSLGGYLPVG------SVGPS-----SIAPLIA 271
                    .|:.||:.|:.    :|..:..:.|.:||: ||.      ::||.     .:|.|.:
  Rat   159 RPAVEKAKTLYRSCMNQSVIEKRDSEPLLNVLDMIGGW-PVAMDKWNETMGPKWELERQLAVLNS 222

  Fly   272 KIYDLGPSPLVDLY---HDLSYGRRPHILLI----ISGPS-------TSSTILERKIRWMSPKAP 322
            :   .....|:||:   .|.:..|  |::.|    :..||       .|..:.|..:::|:..|.
  Rat   223 Q---FNRRVLIDLFIWNDDQNSSR--HVIYIDQPTLGMPSREYYFKEDSHRVREAYLQFMTSVAT 282

  Fly   323 PSRIRQGVPKLLADLIENFLPYFVSYAQRVSEKDTIFEFIKDLNKLQVEHSRRGFWDSTVLYNVS 387
            ..|....:|. ..||::             .|...:......|....|...:|  .|.|.||:..
  Rat   283 MLRRDLNLPG-ETDLVQ-------------EEMAQVLHLETHLANATVPQEKR--HDVTALYHRM 331

  Fly   388 SLQDL-----YPVLNWTLLIPQNWSG---------PIVVRNSDYLKALEYFLTKYPTRVAHNSL- 437
            .|::|     ....||||.|....|.         .:||....||:.||..:..:|.:...|.| 
  Rat   332 GLEELQERFGLKGFNWTLFIQNVLSSVQVELLPNEEVVVYGIPYLENLEEIIDVFPAQTLQNYLV 396

  Fly   438 --LLLSALQILPRDYPSPEVCTRSTMWA------------------LPELSSSLYIAQHSSEDLK 482
              |:|..:..|.:.:....|..|..::.                  :.....||||.:..|:|.|
  Rat   397 WRLVLDRIGSLSQRFKEARVDYRKALYGTTMEEVRWRECVSYVNSNMESAVGSLYIKRAFSKDSK 461

  Fly   483 DTTKRAEIIFKSLKAHLKRAPSL-------KGAALVKLSALKIQSQTWEGF------SNTTDLLK 534
            ...  :|:|.|.....:.....|       |..|..|  ||.|:.|.  |:      .|...|.:
  Rat   462 SIV--SELIEKIRSVFVDNLDELNWMDEESKKKAQEK--ALNIREQI--GYPDYILEDNNRHLDE 520

  Fly   535 SLQPLNITSECWFQNILEIYKKN----------KLEPNDISLNGGSHDAWAY-PIVSTIFYDTLS 588
            ....|..:.:.:|:|.|:..|.|          |::.|          .|.. ..|...||....
  Rat   521 EYSSLTFSEDLYFENGLQNLKNNAQRSLKKLREKVDQN----------LWIIGAAVVNAFYSPNR 575

  Fly   589 HSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSIT---KSFDE---------------- 634
            :.||.|..::..|:|:...|..|::..:|:.|..||.....   ::||:                
  Rat   576 NLIVFPAGILQPPFFSKDQPQALNFGGIGMVIGHEITHGFDDNGRNFDKNGNMLDWWSNFSARHF 640

  Fly   635 -KAMRCVPHSVNIFS----------NYSRM-DILIHSGGMQISYHSMLSLTGPIKGMARLPGLNL 687
             :..:|:.:..:.||          .:|.: :.:..:||::.:|.:.|..........|||||||
  Rat   641 RQQSQCMIYQYSNFSWELADNQNVNGFSTLGENIADNGGVRQAYKAYLQWLAEGGRDQRLPGLNL 705

  Fly   688 TPTQIFFLVSAQELCAESNY--------LGIDTNAPEFDNILGWLVAQGGSATEVFKCPSGSMIN 744
            |..|:||:..||..|  .:|        :..|.::|....:||.|....| .:|.|.||.||.::
  Rat   706 TYAQLFFINYAQVWC--GSYRPEFAIQSIKTDVHSPLKYRVLGSLQNLPG-FSEAFHCPRGSPMH 767

  Fly   745 VQKTCNV 751
            ....|.:
  Rat   768 PMNRCRI 774

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 155/713 (22%)
Mmel1NP_001101467.1 Stop-transfer sequence. {ECO:0000255} 14..21 3/9 (33%)
PepO 99..775 CDD:226118 157/725 (22%)
M13 107..773 CDD:189000 156/714 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.