DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Kel

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001178540.1 Gene:Kel RGDID:1565470 Length:713 Species:Rattus norvegicus

Alignment Length:788 Identity:150/789 (19%)
Similarity:278/789 (35%) Gaps:225/789 (29%)


  Fly    95 WLRTSAAVHKMAITSATLLVTTLLVASPILFLISTAPSPLPRDCYMDGDRCSPAVSAPPECSDPI 159
            |.|.|.....:.:   .:|:..||:...:|::.      :.|:|            .|..|..|:
  Rat    19 WSRQSTRARWVLL---AVLLCGLLIGCSMLWVY------IFRNC------------GPWTCESPV 62

  Fly   160 CEAVASSIQARLNWNKDPCTEFKKFSCWR-NTPNKNITNLIEMGNSQKSVDSQMLYLFQNKIMNG 223
            |..:.:...|..|.:..|||:|..|:|.: |..:.:...|.|...|:         |::.....|
  Rat    63 CMELVNHYLASGNRSAAPCTDFFSFACEKANGTSNSFQALAEENKSR---------LWKLLEAPG 118

  Fly   224 SFGI------LHNLFESCLQQTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLIAKIYDLGPSPL- 281
            |:.:      ....:.||:.                    ..::..|...||:..|.:||...: 
  Rat   119 SWHLESGEEKAFQFYNSCMD--------------------TDAIEASGTGPLVQIIKELGGWNIS 163

  Fly   282 -----VDLYHDL-----SYGRRPHILLIISGPSTSSTILERKIRWMSP-KAPPSR--IRQGVP-- 331
                 .|...:|     .||..|...                 .::.| .|||..  |:...|  
  Rat   164 GNWTFFDFNQNLRLLMSQYGHFPFFR-----------------AYLHPHPAPPHTPIIQIDQPEF 211

  Fly   332 ----------KLLADLIENFLPY-------FVSYAQRVSE--------KDTIFEFIKDLNKLQVE 371
                      |:.|.::..::.|       ..|..|...:        ...:|:|::...:.|.:
  Rat   212 DILLQQDQEQKVYAQILREYVTYLNRLGTLLGSNPQEAQQHASWSIVFTSRLFQFLRPQQQQQAQ 276

  Fly   372 HSRRGFWDSTVLYNV---SSLQDLYPVLNW-----TLLIPQNW--SGPIVVRNSDYLKALEYFLT 426
            ..         |::|   .:||::.|.::|     .:..|.:.  |..:.|.:.|||:.:...:.
  Rat   277 DK---------LFHVVTIDALQEMAPAIDWLSCLQAIFTPMSLSPSQTLQVHDLDYLRNMSQLVE 332

  Fly   427 KYPTRVAHNSLLLLSALQILPRDYPSPEVCTRSTMWALPELSSSLYIAQHSSEDLKD-------- 483
            :   .:.::|.::.|.:.:...|..||.:.|: ...|..||:..|       ..||:        
  Rat   333 E---GLLNHSEIIQSYMILGLVDTLSPALATK-FQEARRELTQKL-------RKLKERPPLPAYP 386

  Fly   484 --------TTKRAEIIFKSLKAHLKRAPSLKGAALVKLSALK------IQSQTWEGFSNTTDLLK 534
                    |....|....:|..|....||::.||:...:.:|      ::..:|.......:.|.
  Rat   387 RWMKCVEQTGSFFEPTLAALFVHEAFGPSIRSAAMELFAEIKDAVIVRLKKLSWISEETRKEALN 451

  Fly   535 SLQPLNI---------TSECWFQNILEIYKKNKLEPNDI--------SLNGGSHDAWAYPI---- 578
            .|..|.:         .:|...|.    |...:|.|:.:        ||.|....::..|.    
  Rat   452 KLTQLQVEMGAPKRALKTEMAKQE----YSDIQLGPSFLQSFLSCVRSLQGRKVRSFLQPFPYHR 512

  Fly   579 -------VSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSI-------- 628
                   ||. :|....|.:|.|..::..|:|:...|..:::.:||..:|.::|...        
  Rat   513 WQKSPWSVSA-YYSVPDHVVVFPAGLLQPPFFHPGYPRAVNFGAVGSIMAHKLLHIFFQFLLPGG 576

  Fly   629 -----TKSFDEKAMRCVPHSVNIF-----SNYSRMDILIHS----GGMQISYHSMLSLTGPIKGM 679
                 |::..| |:.|:.|....|     |:::....|:.:    ||:.|::.:.........|.
  Rat   577 CPACDTRALQE-ALLCLEHRYAAFPLPSMSSFNGSHTLLENAADIGGVAIAFQAYRKRITERTGE 640

  Fly   680 ARLPGLNLTPTQIFFLVSAQELCAE-SNYLGIDTNAPEFDNILGWLVAQGGSATEVFKCPSGSMI 743
            ..||...|:|.|:||...||.:|.| .:....||::|....:.|.| :......:.|.|||||::
  Rat   641 LTLPNQELSPYQLFFRSYAQVMCRELISQDPQDTHSPPRLRVHGPL-SNSPDFAKHFLCPSGSLL 704

  Fly   744 NVQKTCNV 751
            |....|.:
  Rat   705 NPSTRCKL 712

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 134/704 (19%)
KelNP_001178540.1 PepO 75..713 CDD:226118 136/712 (19%)
M13 78..711 CDD:189000 135/706 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.