DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Mmel1

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_038811.2 Gene:Mmel1 MGIID:1351603 Length:766 Species:Mus musculus

Alignment Length:743 Identity:164/744 (22%)
Similarity:275/744 (37%) Gaps:199/744 (27%)


  Fly   155 CSDPICEAVASSIQARLNWNKDPCTEFKKFSC--WRNTPNKNITNLIEMGNSQKSVDSQMLYLFQ 217
            |:.|.|...|:.|...::.:::||..|.:::|  |..      .::|...||:.||    ..:.:
Mouse    76 CTTPSCVIAAARILENMDQSRNPCENFYQYACGGWLR------HHVIPETNSRYSV----FDILR 130

  Fly   218 NKIMNGSFGILHN--------------LFESCLQQTT----NSTVMHRIFDSLGGYLPVG----- 259
            :::.....|:|.:              |:.||:.|:.    :|..:..:...:||: ||.     
Mouse   131 DELEVILKGVLEDSTSQHRPAVEKAKTLYRSCMNQSVIEKRDSEPLLSVLKMVGGW-PVAMDKWN 194

  Fly   260 -SVG-----PSSIAPLIAKIYDLGPSPLVDLY---HDLSYGRRPHILLI----ISGPSTSSTILE 311
             ::|     ...:|.|.::   .....|:||:   .|.:..|  |::.|    :..||......|
Mouse   195 ETMGLKWELERQLAVLNSQ---FNRRVLIDLFIWNDDQNSSR--HVIYIDQPTLGMPSREYYFQE 254

  Fly   312 ---RKIR-----WMSPKAPPSRIRQGVPKLLADLIENFLPYFVSYAQRVSEKDTIFEFIKDLNKL 368
               .|:|     :|:..|...|..|.:.|..|.:.|              |...:.|....|...
Mouse   255 DNNHKVRKAYLEFMTSVATMLRKDQNLSKESAMVRE--------------EMAEVLELETHLANA 305

  Fly   369 QVEHSRRGFWDSTVLY---NVSSLQDLYPV--LNWTLLIPQNWSG---------PIVVRNSDYLK 419
            .|...:|  .|.|.||   ::..||:.:.:  .||||.|....|.         .:||....||:
Mouse   306 TVPQEKR--HDVTALYHRMDLMELQERFGLKGFNWTLFIQNVLSSVEVELFPDEEVVVYGIPYLE 368

  Fly   420 ALEYFLTKYPTRVAHNSL---LLLSALQILPRDYPSPEVCTRSTMWA------------------ 463
            .||..:..|..|...|.|   |:|..:..|.:.:....|..|..::.                  
Mouse   369 NLEDIIDSYSARTMQNYLVWRLVLDRIGSLSQRFKEARVDYRKALYGTTVEEVRWRECVSYVNSN 433

  Fly   464 LPELSSSLYIAQHSSEDLKDTTKRAEIIFKSLKAHLKRAPSL-------KGAALVKLSALKIQSQ 521
            :.....||||.:..|:|.|.|.:  |:|.|.....:.....|       |..|..|  |:.|:.|
Mouse   434 MESAVGSLYIKRAFSKDSKSTVR--ELIEKIRSVFVDNLDELNWMDEESKKKAQEK--AMNIREQ 494

  Fly   522 TWEGF------SNTTDLLKSLQPLNITSECWFQNILEIYKKN----------KLEPNDISLNGGS 570
            .  |:      .|...|.:....|....:.:|:|.|:..|.|          |::.|        
Mouse   495 I--GYPDYILEDNNKHLDEEYSSLTFYEDLYFENGLQNLKNNAQRSLKKLREKVDQN-------- 549

  Fly   571 HDAWAY-PIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSIT---KS 631
              .|.. ..|...||....:.||.|..::..|:|:...|..|::..:|:.|..||.....   ::
Mouse   550 --LWIIGAAVVNAFYSPNRNQIVFPAGILQPPFFSKDQPQSLNFGGIGMVIGHEITHGFDDNGRN 612

  Fly   632 FD-----------------EKAMRCVPH-------------SVNIFSNYSRMDILIHSGGMQISY 666
            ||                 ::..:|:.:             :||.||...  :.:..:||::.:|
Mouse   613 FDKNGNMLDWWSNFSARHFQQQSQCMIYQYGNFSWELADNQNVNGFSTLG--ENIADNGGVRQAY 675

  Fly   667 HSMLSLTGPIKGMARLPGLNLTPTQIFFLVSAQELCAESNY--------LGIDTNAPEFDNILGW 723
            .:.|..........||||||||..|:||:..||..|  .:|        :..|.::|....:||.
Mouse   676 KAYLRWLADGGKDQRLPGLNLTYAQLFFINYAQVWC--GSYRPEFAVQSIKTDVHSPLKYRVLGS 738

  Fly   724 LVAQGGSATEVFKCPSGSMINVQKTCNV 751
            |....| .:|.|.||.||.::..|.|.:
Mouse   739 LQNLPG-FSEAFHCPRGSPMHPMKRCRI 765

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 158/719 (22%)
Mmel1NP_038811.2 PepO 89..766 CDD:226118 159/731 (22%)
M13 97..764 CDD:189000 159/720 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.