DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Mme

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_036740.1 Gene:Mme RGDID:3098 Length:750 Species:Rattus norvegicus

Alignment Length:823 Identity:164/824 (20%)
Similarity:276/824 (33%) Gaps:276/824 (33%)


  Fly   105 MAITSATLLVTTLLVASPILFLISTAPSPLPRDCYMDGDRCSPAVSAPPECSDPICEAVASSIQA 169
            :.|:.:.|::...::|..::.|.:|         |.||           .|....|...|:.:..
  Rat    27 LEISLSVLVLLLTIIAVTMIALYAT---------YDDG-----------ICKSSDCIKSAARLIQ 71

  Fly   170 RLNWNKDPCTEFKKFSC--WRNTPNKNITNLIEMGNSQKSVDSQMLYLFQNKIMNGSFGILHN-- 230
            .::.:.:|||:|.|::|  |..      .|:|...:|:.|                :|.||.:  
  Rat    72 NMDASAEPCTDFFKYACGGWLK------RNVIPETSSRYS----------------NFDILRDEL 114

  Fly   231 ------------------------LFESCLQQTTNSTVMHRIFDSLGGY-----------LPVGS 260
                                    |:.||:.::.        .||.||.           .||.|
  Rat   115 EVILKDVLQEPKTEDIVAVQKAKTLYRSCINESA--------IDSRGGQPLLTLLPDIYGWPVAS 171

  Fly   261 -----------VGPSSIAPLIAKIYDLGPSPLVDLYHDLSYGRRPHILLIISGPSTSSTILERKI 314
                       ....|||.|.:|                 ||::..|...:.....:||  :..|
  Rat   172 QNWEQTYGTSWTAEKSIAQLNSK-----------------YGKKVLINFFVGTDDKNST--QHII 217

  Fly   315 RWMSPK-APPSRIRQGVPKLLADLIENFLPYFVSYAQRVS--------------EKDTIFEFIKD 364
            .:..|: ..|||.......:..:....::.:.:|.|:.:.              |.:.:.|..|:
  Rat   218 HFDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEQRLPIDENQLSLEMNKVMELEKE 282

  Fly   365 LNKLQVEHSRRGFWDSTVLYNVSSLQDLYPVLNWTLLI---PQNWSG-----------------P 409
            :.....:...|.  |..:|||..:|..|..  |::|.|   |.:||.                 .
  Rat   283 IANATTKPEDRN--DPMLLYNKMTLAKLQN--NFSLEINGKPFSWSNFTNEIMSTVNINIQNEEE 343

  Fly   410 IVVRNSDYLKALEYFLTKYPTRVAHNSL---LLLSALQILPRDYPSPEVCTRSTMWALPELSSS- 470
            :||...:||..|:..||||..|...|.:   .::..:..|.|:|.......|..::.....::: 
  Rat   344 VVVYAPEYLTKLKPILTKYSPRDLQNLMSWRFIMDLVSSLSRNYKESRNAFRKALYGTTSETATW 408

  Fly   471 -----------------LYI-------AQHSSEDLKDTTKRAEIIFKSL------KAHLKRAPSL 505
                             ||:       ::|..|||  ..:..|:..::|      .|..|:....
  Rat   409 RRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDL--IAQIREVFIQTLDDLTWMDAETKKKAEE 471

  Fly   506 KGAALVKLSALKIQSQTWEGF-----SNTTDLLKSLQPLNITSECWFQNILEIYK-------KNK 558
            |        ||.|:.:.  |:     ||...|......||...|.:|:||::..|       |..
  Rat   472 K--------ALAIKERI--GYPDDIISNENKLNNEYLELNYKEEEYFENIIQNLKFSQSKQLKKL 526

  Fly   559 LEPNDISLNGGSHDAW-AYPIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAK 622
            .|..|       .|.| :...|...||.:..:.||.|..::..|:|:|.....|:|..:|:.|..
  Rat   527 REKVD-------KDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSARQSNSLNYGGIGMVIGH 584

  Fly   623 EILRSITKSFDEKAMR----------CVPHSVNIFSNYSRMDILIH-------SGGMQI------ 664
            |    ||..||:....          ....|.|.|.:.|:..:..:       :||..:      
  Rat   585 E----ITHGFDDNGRNFNKDGDLVDWWTQQSANNFKDQSQCMVYQYGNFTWDLAGGQHLNGINTL 645

  Fly   665 ---------------SYHSMLSLTGPIKGMARLPGLNLTPTQIFFLVSAQELCA------ESNYL 708
                           :|.:.:...|..|   .||||:|...|:|||..||..|.      ..|.:
  Rat   646 GENIADNGGIGQAYRAYQNYVKKNGEEK---LLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSI 707

  Fly   709 GIDTNAPEFDNILGWLVAQGGSATEVFKCPSGSMINVQKTCNV 751
            ..|.::|....|:|.| .......:.|.|...|.:|.::.|.|
  Rat   708 KTDVHSPGNFRIIGTL-QNSAEFADAFHCRKNSYMNPERKCRV 749

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 151/749 (20%)
MmeNP_036740.1 Stop-transfer sequence. {ECO:0000255} 16..23
PepO 72..750 CDD:226118 153/759 (20%)
M13 77..748 CDD:189000 152/751 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.