DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Ece1

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001356106.1 Gene:Ece1 MGIID:1101357 Length:769 Species:Mus musculus

Alignment Length:849 Identity:174/850 (20%)
Similarity:294/850 (35%) Gaps:265/850 (31%)


  Fly    62 DEIEMIDS-------ANIENFNTRYNKNSIIGWICCAPCIWLRTSAAVHKMAITSATLLVTTL-- 117
            ||.:::||       .|....|.|.:::   |..|.|    .|||  |.|..:...|||...|  
Mouse    26 DEEDLVDSLSEGDVYPNGLQVNFRSSRS---GQRCWA----ARTS--VEKRLVVLVTLLAAGLVA 81

  Fly   118 -LVASPILFLISTAPSPLPRDCYMDGDRCSPAVSAPPECSDPICEAVASSIQARLNWNKDPCTEF 181
             |.|..|.:...|                      ||.|....|.:|.|||...::...|||.:|
Mouse    82 CLAALGIQYQTRT----------------------PPVCLTEACVSVTSSILNSMDPTVDPCQDF 124

  Fly   182 KKFSC--WRNTPNKNITNLIEMGNSQKSVDSQMLYLFQNKIMNGSFGILHNLFESCLQQTTNSTV 244
            ..::|  |..      .|.:..|:|:                   :|...||:|.      |..|
Mouse   125 FSYACGGWIK------ANPVPDGHSR-------------------WGTFSNLWEH------NQAV 158

  Fly   245 MHRIFDSLGGYLPVGSVGPSSIAPLIAKIY-----------DLGPSPLVDLYHDLS--------- 289
            :..:.::        :....|.|...|::|           :|...||::|...|.         
Mouse   159 IKHLLEN--------ATASVSEAERKAQVYYRACMNETRIEELRAKPLMELIEKLGGWNITGPWA 215

  Fly   290 --------------YGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSRIRQ------GVP--- 331
                          |...|...:.:|..|.:|.               |.:.|      |:|   
Mouse   216 KDNFQDTLQVVTAHYRTSPFFSVYVSADSKNSN---------------SNVIQVDQSGLGLPSRD 265

  Fly   332 ---------KLLADLIENFLPYFVSYAQRVSEKD---------TIFEFIKDLNKLQVEHSRRGFW 378
                     |:|.    .:|.|.|...:.:...|         .|.:|...|..:.:...:|.  
Mouse   266 YYLNKTENEKVLT----GYLNYMVQLGKLLGGGDEDAIRPQMQQILDFETALANITIPQEKRR-- 324

  Fly   379 DSTVLYN---VSSLQDLYPVLNW-----TLLIPQ--NWSGPIVVRNSDYLKALEYFLTKYPTRVA 433
            |..::|:   .:.||.|.|.:||     |:..|.  |.|.||||.:.:||:.:...:......:.
Mouse   325 DEELIYHKVTAAELQTLAPAINWLPFLNTIFYPVEINESEPIVVYDKEYLRQVSTLINNTDKCLL 389

  Fly   434 HNSL---LLLSALQILPRDY-------------------PSPEVCTRSTMWALPELSSSLYIAQH 476
            :|.:   |:......|.:.:                   |..:.|...|...|......:::...
Mouse   390 NNYMMWNLVRKTSSFLDQRFQDADEKFMEVMYGTKKTCIPRWKFCVSDTENNLGFALGPMFVKAT 454

  Fly   477 SSEDLKDTTKRAEIIFKSLKAHLKRAPSLK-------GAALVKLSALKIQSQTWEGFSN----TT 530
            .:||.|:..  :|||.:..||..:...:||       .:|..|..|:    ....|:.|    ..
Mouse   455 FAEDSKNIA--SEIIMEIKKAFEESLSTLKWMDEETRRSAKEKADAI----YNMIGYPNFIMDPK 513

  Fly   531 DLLKSLQPLNITSECWFQNILEIYKKNKLEPNDISLNGGSHDAWAY--PIVSTIFYDTLSHSIVV 593
            :|.|.........:.:|:|.:..:..:.....|......:.|.|:.  |:|:. :|....:.||.
Mouse   514 ELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNA-YYSPTKNEIVF 577

  Fly   594 PLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSITKSFDEKA---------------------- 636
            |..::..|::....|..|::..:||.:..|    :|.:||::.                      
Mouse   578 PAGILQAPFYTRSSPNALNFGGIGVVVGHE----LTHAFDDQGREYDKDGNLRPWWKNSSVEAFK 638

  Fly   637 --MRCVPHSVNIFSNYS--------RMDI---LIHSGGMQISYHSMLSLTGPIKGMARLPGLNLT 688
              ..|:   |..:||||        |..:   :..:||::.:|.:..:..........||.|.||
Mouse   639 QQTECM---VQQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEQTLPTLGLT 700

  Fly   689 PTQIFFLVSAQELCA----ESNYLGI--DTNAPEFDNILGWLVAQGGSATEVFKCPSGSMINVQK 747
            ..|:|||..||..|:    ||::.|:  |.::|....::|.| :.....:|.|:||.||.:|...
Mouse   701 SNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSL-SNSKEFSEHFRCPPGSPMNPHH 764

  Fly   748 TCNV 751
            .|.|
Mouse   765 KCEV 768

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 141/722 (20%)
Ece1NP_001356106.1 M13 118..767 CDD:341056 142/724 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.