DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-25

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_495164.2 Gene:nep-25 WormBaseID:WBGene00022874 Length:515 Species:Caenorhabditis elegans

Alignment Length:573 Identity:99/574 (17%)
Similarity:188/574 (33%) Gaps:197/574 (34%)


  Fly   270 IAKIYDLGPSPLVDLYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSRIRQGVPKLL 334
            |.|..|....|.||.|        .|:                     .|........:.:.||.
 Worm    32 IKKHADFSVDPCVDFY--------AHV---------------------CPWKVERYFMEDLSKLK 67

  Fly   335 ADLIENFL---PYFVSYAQRVSEKDTIFEFIKDLNKLQVEHSRR-------GFW----DSTVLYN 385
            |.::..:.   |.|..:  :..:...|.|.:|.||..|::...:       .|:    |:..:.|
 Worm    68 AGMVAKYRKKHPKFDKF--KGEDAFAIAEALKQLNIEQLKSECKPSKPRLSSFFISAQDNRTIEN 130

  Fly   386 VSSLQDLYPVL-NWTLLIPQNWSGPIVVRNSDYLKALEYFLTKYPTRVAHNSLL---LLSALQIL 446
            |..:  |:|.. |:    |......|:::....::  :|..|:.....|.|..:   |:..|.:.
 Worm   131 VDEV--LFPGFENY----PCEEKAAIIIKEVGEIE--DYTTTRSVLVSAVNGFITSKLVEKLDVK 187

  Fly   447 PR-------DYPSPEVCTRSTMWALPELSSSLYIAQHSS------EDLKDTTKRAEIIFKSLKAH 498
            .|       ...|.|:.  .|.||....:...|:...|:      .|::.|.|::..:::|.:..
 Worm   188 ARKLFNKFKSVISKEII--KTPWAKNYKAIEQYVEALSNITFRTFADVRITVKKSMELYESTEKD 250

  Fly   499 LKRAPSLKGAALVKLSALKIQSQTWEGFSN-TTDLLKSLQPLNITSECWFQNILEIYKKNKLEPN 562
            .::          ||..         .||. |.:|:..........|...:.|.:|:      |.
 Worm   251 CRK----------KLDV---------AFSQPTAELVCKGVATRKAEELLDEPIEDIF------PQ 290

  Fly   563 DISLNGGSHDAWAYPIVSTIFYDTLSHSIVVPLSVILI---PYFNAVLPPYLHYASVGVSIAKEI 624
            |.:  |...|.|.       .:::..:|:.:....:|:   .||:.:      |.|:|.|:..||
 Worm   291 DQA--GILKDVWQ-------MFNSFDNSVYIGNEFLLLLNTDYFSDL------YGSIGFSMIHEI 340

  Fly   625 LRSI------------------------------------------------TKSFDEKAMRCVP 641
            :.::                                                |.:|:|.|.....
 Worm   341 MHTLVFDDNDLDKPLSKLWTKNADCVKDQALKTCETFPTVTEMHNMKPACNTTVTFEEDAADLAA 405

  Fly   642 HSV--NIFSN-YSRMDILIHSGGM---QISYHSMLSLTGPIKGMARLPGLNLTPTQIFFLVSAQE 700
            :.:  .|:.| |:|..::.:...:   |:.::..........||:|:|              .|.
 Worm   406 YRIAWRIYENSYARKTVVPNYEALDKKQLFFYGAAVFFCNQDGMSRVP--------------FQN 456

  Fly   701 LCAESNYLGIDTNAPEFDNILGWLVAQGGSATEVFKC-PSGSMI-NVQKTCNV 751
            |...:||..:::           |::|....::.||| |:..|| |..|.|.:
 Worm   457 LAHSNNYQRVNS-----------LMSQMKQFSDAFKCKPTDKMITNRAKHCEL 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 98/570 (17%)
nep-25NP_495164.2 Peptidase_M13 308..496 CDD:279739 37/219 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.