DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-24

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_503005.3 Gene:nep-24 WormBaseID:WBGene00013786 Length:567 Species:Caenorhabditis elegans

Alignment Length:684 Identity:125/685 (18%)
Similarity:228/685 (33%) Gaps:224/685 (33%)


  Fly   123 ILFLISTAP------SPLPRDCYMDGDRCSPAVSAPPECSDPICEAVASSIQARLNWNKDPCTEF 181
            :|.|..|||      :|..|:.                |:.|.|..:|..:....:.:.|||..|
 Worm    16 LLLLTCTAPLAIGATTPATRNV----------------CNTPACITLAHMLHNYHDPSVDPCDNF 64

  Fly   182 KKFSCWR----------NTPNKNITNLIEMGNSQKSVDSQMLYLFQNKIMNG-SFGILHNLFESC 235
            .:|:|.|          ....|.|.|:::.            :|.:|:.... |...:..|:::|
 Worm    65 HQFACGREHEHETEDIYTKKTKTINNIMKR------------FLKKNETSRSKSENAMRTLYKAC 117

  Fly   236 LQQTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLIAKIYDLGPSPLVD-------------LYHD 287
            .....|||....                .::..:...|..:|..|:||             |.:.
 Worm   118 KTLEKNSTASRN----------------KALQDIFQDIQSIGAWPVVDDKWDESKFDLNDFLVNL 166

  Fly   288 LSYGRRPHILLIIS----------GP-----------STSSTILERKIRWMSPKAPPSRIRQGVP 331
            :..||:...|..::          ||           .|.|.||:           .:.::....
 Worm   167 VRLGRKNFGLFQMARYVNVRNFAIGPEAAWRHNVDLGKTISEILK-----------ANSVQTNNK 220

  Fly   332 KLLADLIENFLPYFVSYAQRVSEKDTIFEFIKDLNKLQVEH--SRRGFWDSTVLYNVSSL----- 389
            |||.||.|     :|:..:.:|:        ...|.:|..:  |.|..:.|:|  |.|.|     
 Worm   221 KLLDDLAE-----YVNLEKALSQ--------HKFNTVQPGYIFSERSDFVSSV--NFSRLVLEMM 270

  Fly   390 ----QDLYP-------VLNWTLLIPQNWSGPIVVRNSDYLKALEYFLTKY-PTRVAHNSLLLLSA 442
                :.|:|       :.|.:|...:|.:...::||:.......|.:.|: .|.:|..:      
 Worm   271 SPDKRTLFPEVYQIMYLTNTSLFFGKNNNLETIIRNTSKRALANYLIFKFIDTSIADLT------ 329

  Fly   443 LQILPRDYPSPEV-CTRSTMWALPELS-SSLYIAQHSSEDLKDTTKRAEI----IFKSLKAHLKR 501
                   |.||.. |.:..:..||..: .:.|....|.|:.|..||..|.    :.|.:.|....
 Worm   330 -------YGSPSAFCEQKVINFLPRAALRAFYRNFISKENRKKITKLTEATQVQLLKIIGATDWM 387

  Fly   502 APSLKGAALVKLSALKIQSQTWEGFSNTTDLLKSLQPLNITSECWFQNILEIYKKNK-LEPNDIS 565
            :...|..|:.::|::.:.....:.|.....|....:.||::|...:..:  :.|.|: :...::.
 Worm   388 SIKSKKIAMDRVSSMNMVIGYPDYFDPPGKLDGLFEHLNLSSSDTYYTV--VRKINRFMREQEMD 450

  Fly   566 LNGGSHDAWAYP----IVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILR 626
            ...|  :...||    :::...|:...:::::.......|:|::..|.|.:.|....::|     
 Worm   451 YYTG--EVPYYPLFPGLMTNAMYNANDNNLMIFAPFFDDPFFDSSFPDYANIAFTSNTLA----- 508

  Fly   627 SITKSFDEKAMRCVPHSVNIFSNYSRMDILIHSGGMQISYHSMLSLTGPIKGMARLPGLNLTPTQ 691
                                           |..|...|.|.|..:||..:       :.|||.:
 Worm   509 -------------------------------HEMGHTFSPHLMDIMTGTTE-------VWLTPKE 535

  Fly   692 IFFLVSAQEL-----CAESNYLGIDTNAPEFDNI 720
                  .:|.     |.|..|...|.  ||:..|
 Worm   536 ------TEEYEKRVKCLEDQYTEYDD--PEYGRI 561

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 114/626 (18%)
nep-24NP_503005.3 GluZincin 58..561 CDD:301352 113/625 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.