DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and ECE1

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:XP_011539174.1 Gene:ECE1 HGNCID:3146 Length:778 Species:Homo sapiens

Alignment Length:869 Identity:172/870 (20%)
Similarity:294/870 (34%) Gaps:280/870 (32%)


  Fly    52 PVGSKQM-----GKSDEIEMIDSAN---------IENFNTRYNKNSIIGWICCAPCIWLRTSAAV 102
            |.||..|     ...||.:::||.:         ..||::..:     |..|.|    .||.  |
Human    20 PRGSNSMSTYKRATLDEEDLVDSLSEGDAYPNGLQVNFHSPRS-----GQRCWA----ARTQ--V 73

  Fly   103 HKMAITSATLLVTTLLVASPILFLISTAPSPLPRDCYMDGDRCSPAVS------APPECSDPICE 161
            .|..:....||...|:.                         |..|:.      :|..|....|.
Human    74 EKRLVVLVVLLAAGLVA-------------------------CLAALGIQYQTRSPSVCLSEACV 113

  Fly   162 AVASSIQARLNWNKDPCTEFKKFSC--WRNTPNKNITNLIEMGNSQKSVDSQMLYLFQNKIMNGS 224
            :|.|||.:.::...|||.:|..::|  |..      .|.:..|:|:                   
Human   114 SVTSSILSSMDPTVDPCHDFFSYACGGWIK------ANPVPDGHSR------------------- 153

  Fly   225 FGILHNLFESCLQQTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLIAKIY-----------DLGP 278
            :|...||:|.      |..::..:.::        |....|.|...|::|           :|..
Human   154 WGTFSNLWEH------NQAIIKHLLEN--------STASVSEAERKAQVYYRACMNETRIEELRA 204

  Fly   279 SPLVDLYHDLS-----------------------YGRRPHILLIISGPSTSSTILERKIRWMSPK 320
            .||::|...|.                       |...|...:.:|..|.:|.            
Human   205 KPLMELIERLGGWNITGPWAKDNFQDTLQVVTAHYRTSPFFSVYVSADSKNSN------------ 257

  Fly   321 APPSRIRQ------GVP------------KLLADLIENFLPYFVSYAQRVSEKD---------TI 358
               |.:.|      |:|            |:|.    .:|.|.|...:.:...|         .|
Human   258 ---SNVIQVDQSGLGLPSRDYYLNKTENEKVLT----GYLNYMVQLGKLLGGGDEEAIRPQMQQI 315

  Fly   359 FEFIKDLNKLQVEHSRRGFWDSTVLYN---VSSLQDLYPVLNW-----TLLIPQ--NWSGPIVVR 413
            .:|...|..:.:...:|.  |..::|:   .:.||.|.|.:||     |:..|.  |.|.||||.
Human   316 LDFETALANITIPQEKRR--DEELIYHKVTAAELQTLAPAINWLPFLNTIFYPVEINESEPIVVY 378

  Fly   414 NSDYLKALEYFLTKYPTRVAHNSL---LLLSALQILPRDY-------------------PSPEVC 456
            :.:||:.:...:......:.:|.:   |:......|.:.:                   |..:.|
Human   379 DKEYLEQISTLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQDADEKFMEVMYGTKKTCLPRWKFC 443

  Fly   457 TRSTMWALPELSSSLYIAQHSSEDLKDTTKRAEIIFKSLKAHLKRAPSLK-------GAALVKLS 514
            ...|...|......:::....:||.|...  .|||.:..||..:...:||       .:|..|..
Human   444 VSDTENNLGFALGPMFVKATFAEDSKSIA--TEIILEIKKAFEESLSTLKWMDEETRKSAKEKAD 506

  Fly   515 ALKIQSQTWEGFSN----TTDLLKSLQPLNITSECWFQNILEIYKKNKLEPNDISLNGGSHDAWA 575
            |:    ....|:.|    ..:|.|.........:.:|:|.:..:..:.....|......:.|.|:
Human   507 AI----YNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWS 567

  Fly   576 Y--PIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSITKSFDE---- 634
            .  |:|:. :|....:.||.|..::..|::....|..|::..:||.:..|    :|.:||:    
Human   568 MTPPMVNA-YYSPTKNEIVFPAGILQAPFYTRSSPKALNFGGIGVVVGHE----LTHAFDDQGRE 627

  Fly   635 --------------------KAMRCVPHSVNIFSNYS--------RMDI---LIHSGGMQISYHS 668
                                :...|:   |..:||||        |..:   :..:||::.:|.:
Human   628 YDKDGNLRPWWKNSSVEAFKRQTECM---VEQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRA 689

  Fly   669 MLSLTGPIKGMARLPGLNLTPTQIFFLVSAQELCA----ESNYLGI--DTNAPEFDNILGWLVAQ 727
            ..:..........||.|.||..|:|||..||..|:    ||::.|:  |.::|....::|.| :.
Human   690 YQNWVKKNGAEHSLPTLGLTNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSL-SN 753

  Fly   728 GGSATEVFKCPSGSMINVQKTCNV 751
            ....:|.|:||.||.:|....|.|
Human   754 SKEFSEHFRCPPGSPMNPPHKCEV 777

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 141/722 (20%)
ECE1XP_011539174.1 PepO 114..769 CDD:226118 144/730 (20%)
M13 127..776 CDD:189000 142/724 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.