DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-20

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001317749.1 Gene:nep-20 WormBaseID:WBGene00020293 Length:834 Species:Caenorhabditis elegans

Alignment Length:842 Identity:158/843 (19%)
Similarity:297/843 (35%) Gaps:267/843 (32%)


  Fly    27 NLITTANPSGGSSASLLQKQLSFKTPVGSKQMGKSDEIEMID-SANIENFNTRYNKNSIIGWICC 90
            |.:..|||...:..::.:|.   |.....|:..|:::....: :|||        |:.||.  |.
 Worm   138 NPVNPANPVIPAKQNMEKKN---KRKEKEKERKKAEKFSADEKTANI--------KDRIIN--CV 189

  Fly    91 APCI-----WLRTSAAVHKMAITSATLLVTTLLVASPILFLISTAPSPLPRDCYMDGDRCSPAVS 150
            .|.|     ||                          :||:               |.|..   .
 Worm   190 YPVILIILFWL--------------------------LLFI---------------GARQD---E 210

  Fly   151 APPECSDPICEAVASSIQARLNWNKDPCTEFKKFSC-----------WRNTPNKNITNLIEMGNS 204
            .|..|..|.|..:|..:.|..:.:...|..|.|.:|           .|:...|.:.        
 Worm   211 KPSLCESPQCITLAFELSAYQDTSVSKCHNFYKATCGKYKHHQALDKHRDAKKKEVV-------- 267

  Fly   205 QKSVDSQMLYLFQNKIMNGSFGILHNLFESCLQQTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPL 269
             |.:..:.|...::.|.:.....:..:|..|.:.:.|.|           ||.:           
 Worm   268 -KRIVREFLRRNESSITSKFEPAIRLMFGKCNKFSQNKT-----------YLDI----------- 309

  Fly   270 IAKIYDLGPSPLVDL-YHDLSYGRRPHILLIISGPSTSSTILERKIRWMS----PKAPPSRIRQG 329
            ...|..:||.|::.. :.|:.:....::|.::....|...:.:.:.|.::    |...||..:||
 Worm   310 FKDIEKIGPWPVLKSDWVDVMFNLNDYLLSLVELGFTDFGLFKLEFRQLAFGQFPVIAPSEQKQG 374

  Fly   330 --VPKLLADLIENFLPYFVSYAQRV-SEKDTIFEFIKDLN--KLQVEH-SRRGFWDSTVLYNVSS 388
              :.|::.:::|         |..| :::..:.:::::.:  |.|:.| |..|.....:.||.|:
 Worm   375 NQLEKIILEILE---------ANGVQADRQKLSKYLREYSEFKSQLRHMSLEGTSVKYIRYNAST 430

  Fly   389 L--------QDLYPVLNWTLLIPQNWSGPIVVRNSD-------------------------YLKA 420
            |        |.:.|:...:.|:.:..||.::..:|.                         ::.|
 Worm   431 LSVNISALVQKMAPMSTSSGLVRRIQSGILITNSSSFFGKNLDAIIQQTHKRTLANYLIFHFIDA 495

  Fly   421 LEYFLTKYPTRVAHNSLLLL--SALQILPRDYPSPEVCTRSTMWALPELSSSL------YIAQHS 477
            :.:.||.......|..:.||  .:||:|.:|:...|     ....:.|::..|      .|::.|
 Worm   496 VTFDLTSGAKHSEHTLIDLLPRGSLQVLSQDFVDEE-----DQGVMVEMAKDLKKHVVEMISEGS 555

  Fly   478 SEDLKDTTKRAEIIFKSLKAHLKRAPSLKGAALVKLSALKIQSQTWEGFSNT--TDLLKSLQPL- 539
            |.|      :..::|:. |...|....::...:|....|:|.:|.:|..:.|  ..|.|.:|.| 
 Worm   556 SLD------KGHLVFEE-KERRKLIRKVQDILVVTKYPLEILNQNFEKLNLTYSDSLHKIIQKLR 613

  Fly   540 NITSECWFQNILEIYKKNKLEPNDISLNGGSHDAWAYPIVSTIFYDTLSHSIVVPLSVILIPYFN 604
            ...||    .::| |....|:|.|..:.|.:|            |:..::.:::...:|..|||:
 Worm   614 RFRSE----QLIE-YLGGDLDPTDKGMWGSAH------------YEQATNDLIIIAPIIDGPYFD 661

  Fly   605 AVLPPYLHYASVGVSIAKEILRSITK---SFDEKAMRCVPHSVNIFSNYS--RMD---------- 654
            ...|.|::...:|..|::|:.||:..   ..|||.     |:.|...:.|  |.|          
 Worm   662 TSYPNYVNIFFMGFIISRELGRSLDSVRIRKDEKG-----HTENWLKSESLKRFDNNVKCWRKKI 721

  Fly   655 --------ILIHSGGMQISYHSMLSLTGPIKG--MARLPGL-NLTPTQIFFLVSAQELC------ 702
                    :|....|.:.|:.::......:.|  :.::.|. ::|..||||.:.|...|      
 Worm   722 TGTRFLNEMLADHVGHEASFMALKKWEKEMNGTIVEKIRGYESMTMEQIFFHLQALYFCRPPGGS 786

  Fly   703 --------AESNYLGIDT-------NAPEFDNILGWLVAQGGSATEVFKCPSGSMINVQKTC 749
                    |..:|   .|       |.|:|              .:.|.|.|...:|.:..|
 Worm   787 TGELTAKDARQHY---STRVNEAFKNMPQF--------------AKAFGCSSNQNMNSKTKC 831

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 128/686 (19%)
nep-20NP_001317749.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.