DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-18

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_494297.1 Gene:nep-18 WormBaseID:WBGene00019343 Length:701 Species:Caenorhabditis elegans

Alignment Length:758 Identity:146/759 (19%)
Similarity:250/759 (33%) Gaps:237/759 (31%)


  Fly   151 APPECSDPICEAVASSIQARLNWNKDPCTEFKKFSCWRNTPNKNITNLIEMGNSQKSVD-SQMLY 214
            :|..|....|..|.:.|:...|.:.|||.:|.:.:|.|.:.:      :...||...|. .|:||
 Worm    23 SPETCWSKECVGVLAMIKNYQNASVDPCEDFFEHTCGRYSEH------VMDDNSWGYVQYKQLLY 81

  Fly   215 -LF-----QNKIMNGSFGILHNLFESCL--QQTTNSTV--MHRIFDSLGGYLPVGSVGPS----- 264
             :|     .||..:.....|....:|||  ::....|.  :....:..||: |:  :.|:     
 Worm    82 QVFAIARKTNKFNSKPNEQLRIFTKSCLDRKEMDEDTFQDLRNDIEERGGF-PM--IDPNWNEEK 143

  Fly   265 -SIAPLIAKIYDLGPSPL----VDLYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPS 324
             .::.::||...:..:.:    |:.|..:...:..:.|.:..||           .|:...|...
 Worm   144 FDLSDMLAKYLSINRNRMGFLSVEPYAAIEGNKSVNRLYVSPGP-----------HWVYNWAMGI 197

  Fly   325 RI-RQGVPKLLADLIE------NFLPYFVSYAQRVSEKDTIFEFIKDLNKLQVEHSRRGFWDSTV 382
            .| :..|..:|..|::      |...|...:|:.| :.:..|..:.|...|.:::.     :.:.
 Worm   198 SIYKDSVAFMLRRLLKLENRELNETIYDKEFAELV-QLEANFSTLADYRNLALDND-----NMSK 256

  Fly   383 LYNVSSLQDLYPVLNWTLLIPQNWSGPIVVRNSDYLKAL-----------------------EYF 424
            ..|::.|..:.|.::|..:                ||||                       |||
 Worm   257 SRNLTDLVKMIPEIDWIKI----------------LKALARHGTSEEDEEKLLERVTVHGAGEYF 305

  Fly   425 L----------TKYPTRVAHNSL----LLLSALQILPRDYP----------SPEVCTRSTMWALP 465
            .          |:.|.....|.|    |:..||....:|.|          ....|........|
 Worm   306 FGENRELARIATETPKSALANYLVVRQLIDVALYFYDKDQPRQNKFYNHVDQQSFCATQVASFFP 370

  Fly   466 ELSSSLYIAQHSSEDLKDTTKRAEIIFKSLKAHLKR--------APSLKGAALVKLSALKIQ--- 519
            ..|.:::|  .||:...:..|..|.:|..:||..::        ...::...:.||:|:..:   
 Worm   371 MPSMNVFI--ESSQFKIENLKVIEEMFVKIKAEYEQIFTENEYLELEIREFLIRKLNAIDGKFGL 433

  Fly   520 SQTWEG------FSNTTDLLKSLQPLNITSECW----FQNILEIYKKNKLEPNDISLNGGSHDAW 574
            .|..||      ...|.:.|.:..|..:..:.|    .|.:..|.....|:|.::.: .|:|.|:
 Worm   434 DQYTEGKPLLEKMYETLNFLDTDSPWQVYMKMWRHWSEQLVEHIVHDTPLDPVNLKM-FGTHAAY 497

  Fly   575 -AYPIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEI-------LRSITKS 631
             .||   ..||        :.|..:..|:.:|..|...:|..:|..|..||       .|.:.:|
 Worm   498 QPYP---NHFY--------INLPYLTYPWMDADFPANTNYGYLGYVIGHEIGHAFDHFHRKLDES 551

  Fly   632 -------------------FDEKAMRCVPHSVNIFSNYSRMDILIHSGGMQISYHSMLSLTGPIK 677
                               ..||.:|      :.:|.|..........|.    |....:.|...
 Worm   552 GRQQQYWFTETNSSNTEYELREKCLR------DQYSAYKEPGYDFFMNGT----HCRYEIAGDHM 606

  Fly   678 GMA---------------RLPGLNLTPTQIFFLVSAQELC-------AESNYL------------ 708
            |:.               |||||.::..|:||...|...|       ...|.|            
 Worm   607 GIRTAFRVFEKVKKEDRFRLPGLEMSEEQLFFYNYAFRQCDVYNPNKLPRNMLARQHPTNRYRVN 671

  Fly   709 GIDTNAPEFDNILGWLVAQGGSATEVFKCPSGSMINVQKTCNV 751
            |:..|.|||              .|.|.||..|.:|.:..|.:
 Worm   672 GVIQNIPEF--------------AEAFNCPKNSPMNPEMKCKL 700

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 139/730 (19%)
nep-18NP_494297.1 PepO 42..692 CDD:226118 139/730 (19%)
M13 47..699 CDD:189000 140/732 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.