DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Phex

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_035207.1 Gene:Phex MGIID:107489 Length:749 Species:Mus musculus

Alignment Length:808 Identity:150/809 (19%)
Similarity:277/809 (34%) Gaps:235/809 (29%)


  Fly    96 LRTSAAVHKMAITSATLLVTTLLVASPILFLISTAPSPLPRDCYMDGDRCSPAVSAPPE-CSDPI 159
            :.|....::....:..|.:...||...:|||:|..               ..:..|..| |..|.
Mouse     9 METGKGTNRGIRIALALFIGGTLVLGTLLFLVSQG---------------LLSFQAKQEYCLKPE 58

  Fly   160 CEAVASSIQARLNWNKDPCTEFKKFSC--------------------W-RNTPNKNITNLIEMGN 203
            |...|::|.:::|.:.|||..|.:|:|                    | |:..:..:..|:|...
Mouse    59 CIEAAAAIMSKVNLSVDPCENFFRFACDGWISNNPIPEDMPSYGVYPWLRHNVDLKLKALLEKSV 123

  Fly   204 SQKSVDSQMLYLFQNKIMNGSFGILHNLFESCLQQTTNSTVMHRIFDSLGGYLPV--GSVGPSSI 266
            |::. |::.:.  :.||:..|.     :.|..:::.....::|.:..|...: ||  .::||..:
Mouse   124 SRRR-DTEAVQ--KAKILYSSC-----MNEKAIEKADAKPLLHILRHSPFRW-PVLEANIGPEGV 179

  Fly   267 APLIAKIYDLGPSPLVDLYHDLSYGRRPHILL----IISGPSTSSTILERKIRWMSPKAPPSR-- 325
                                   :..|...||    ...|..::|..:.   .::||....|.  
Mouse   180 -----------------------WSERKFSLLQTLATFRGQYSNSVFIR---LYVSPDDKASNEH 218

  Fly   326 -IRQGVPKLLADLIENFLPYFVSYAQRVSEKDTIFEFIKD------------------------- 364
             ::.....|...:.|:||.   :..:..|.:|.:::|:.|                         
Mouse   219 ILKLDQATLSLAVREDFLD---NTTEAKSYRDALYKFMVDTAVLLGANSSRAEHDMKSVLRLEIK 280

  Fly   365 LNKLQVEHSRRGFWDSTVLY---NVSSLQDLYPVLNW---------TLLIPQ-NWSGP---IVVR 413
            :.::.:.|..|   .|..:|   |:|.|..:.|..:|         |.|.|. ...||   :|||
Mouse   281 IAEIMIPHENR---TSEAMYNKMNISELSAMIPQFDWLGYIKKVIDTRLYPHLKDIGPSENVVVR 342

  Fly   414 NSDYLKALEYFLTKYPTRVAHNSL---LLLSALQILPRDY------------------PSPEVCT 457
            ...|.|.|...|.....:...|.|   ::.|.:..|.|.:                  |..:.|.
Mouse   343 VPQYFKDLFRILGAERKKTIANYLVWRMVYSRIPNLSRRFQYRWLEFSRVIQGTTTLLPQWDKCV 407

  Fly   458 RSTMWALPELSSSLYIAQHSSEDLKDTTKR---------AEIIFKS---LKAHLKRAPSLKG-AA 509
            .....|||.:...:::..|..||.|:..:.         .:::.|.   :.|..||....|. |.
Mouse   408 NFIESALPYVVGKMFVNVHFQEDKKEMMEELIEGVRWAFIDMLEKENEWMDAGTKRKAQEKARAV 472

  Fly   510 LVKLSALKIQSQTWEGFSNTTDLLKSLQPLNITSECWFQNILEIYK---------KNKLEPNDIS 565
            |.|:...       |...|.|.:.:.|:.:..:...:|.|:|:..|         ..|..|..  
Mouse   473 LAKVGYP-------EFIMNDTYVNEDLKAIKFSESDYFGNVLQTRKYLAQSDFFWLRKAVPKT-- 528

  Fly   566 LNGGSHDAWAYPIVSTIFYDTLSHSIVVPLSVILIPYF-NAVLPPYLHYASVGVSIAKEILRSI- 628
                  :.:..|.....||...::.|..|...:..|:| ....|..|.|.::||.:..|..... 
Mouse   529 ------EWFTNPTTVNAFYSASTNQIRFPAGELQKPFFWGTEYPRSLSYGAIGVIVGHEFTHGFD 587

  Fly   629 --------------------TKSFDEKAMRCVPHSVNIFSNY----SRMDI---------LIHSG 660
                                .:.|.||. :|:   :|.:|||    :.:::         :..:|
Mouse   588 NNGRKYDKNGNLDPWWSVESEEKFKEKT-KCM---INQYSNYYWKKAGLNVKGKRTLGENIADNG 648

  Fly   661 GMQISYHSMLS-LTGPIKGMAR--LPGLNLTPTQIFFLVSAQELC------AESNYLGIDTNAPE 716
            |::.::.:... :....:|:..  |||:..|..|:|||..|...|      |....:.|..::|.
Mouse   649 GLREAFRAYRKWINDRRQGVEEPLLPGITFTNNQLFFLSYAHVRCNSYRPEAAREQVQIGAHSPP 713

  Fly   717 FDNILGWLVAQGGSATEVFKCPSGSMIN 744
            ...:.| .::......:.|.||..|.:|
Mouse   714 QFRVNG-AISNFEEFQKAFNCPRNSTMN 740

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 134/728 (18%)
PhexNP_035207.1 PepO 67..741 CDD:226118 135/736 (18%)
M13 74..747 CDD:189000 134/729 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.