DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and F41C6.4

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001129930.1 Gene:F41C6.4 WormBaseID:WBGene00018278 Length:393 Species:Caenorhabditis elegans

Alignment Length:80 Identity:12/81 (15%)
Similarity:25/81 (31%) Gaps:28/81 (35%)


  Fly   171 LNWNKDPCTEFKKFSC----------------------------WRNTPNKNITNLIEMGNSQKS 207
            ::.:.|||.:|.:.:|                            |.|...:...|.|:.|..:..
 Worm    29 IDQSSDPCDDFYRHACPVGDYDFLVLMKYAPIFKELETSQEESAWENLKIEEALNNIKPGEIENE 93

  Fly   208 VDSQMLYLFQNKIMN 222
            :.:....:|.:...|
 Worm    94 ISAYFERVFLDMCQN 108

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 12/76 (16%)
F41C6.4NP_001129930.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.