DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-8

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001309548.1 Gene:nep-8 WormBaseID:WBGene00017553 Length:686 Species:Caenorhabditis elegans

Alignment Length:699 Identity:122/700 (17%)
Similarity:239/700 (34%) Gaps:249/700 (36%)


  Fly   155 CSDPICEAVASSIQARLNW---NKDPCTEFKKFSCWRNTPNKNITNLIEMGNSQKSVDSQMLYLF 216
            |..|.|..::..:   ||:   :.|||.:|.:.||.|........:.::   .:|.:..:.:..|
 Worm    56 CDSPECITLSHEL---LNYQDPSVDPCVDFFQHSCGRFHEQSVSESRLQ---KKKHILRKQIREF 114

  Fly   217 QNKIMNG---SFGILHNLFESC--LQQTTNST------VMHRIFD---SLGGYLPVGSVGPSSIA 267
            .:||.|.   |..::..:|:.|  .::|:|..      .:|.:|:   .:|.:            
 Worm   115 LHKIQNSTSKSENLMKLVFDKCEASKKTSNDNYKISRDAIHDVFNDIKKIGAW------------ 167

  Fly   268 PLIAKIYDLGPSPLVDLYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSRIRQG--- 329
            ||:.|.:|.....|.::..:|           :...:|:..:.:...|.::         :|   
 Worm   168 PLLDKNWDGSKFDLNEMLSNL-----------VKLGATNLGLFQLDFRILT---------EGKFV 212

  Fly   330 -VPKLLADLIENFLPYFVSYAQRVSEKDTIFEFIKDLNKLQVEHSRRGFWDSTVLYNVSSLQDLY 393
             :...|..::.|  ...:|....:.|.:.:....::::|...|:              ||||   
 Worm   213 RIAPTLGSIVHN--STMISMISEILEANGVQPDSEEISKEFEEY--------------SSLQ--- 258

  Fly   394 PVLNWTLLIPQNWSGPIV-----VRNSDYLKALEYFLTKYPTRVAHNSLLLLSALQILPRDYP-- 451
                 ..|.....||.:.     ||:.::...:...:  :|:||:.    :...::::..::|  
 Worm   259 -----MKLAKYQSSGKLSISLPGVRSINFSSLITEMI--HPSRVSK----IFGKIRVVTSEHPLF 312

  Fly   452 --------------SPEVCTRSTMWALPELSSSLYIAQ-----HSSEDLKDTTKRAEI-IF---- 492
                          |....|.:.......:.||..|.:     :..:|::....||.: :|    
 Worm   313 FKSNETESLDTIIESTSNKTLANFLIFNYIQSSYNIMKGARRGNCEDDVRREFPRASLRVFMRNF 377

  Fly   493 ---------KSLKAHLKR------------APSLKGAALVKLSALKIQ-------------SQTW 523
                     |.|...||:            ||.:|.:.|.|:.|:|:.             .:.:
 Worm   378 VDKGNRDGVKKLTEELKKNTLEMIQDTENLAPPVKESMLKKVEAIKVTIGYPDHFDPPGTLDKEF 442

  Fly   524 EGF--SNTTDLLKSLQPLN----------ITSECWFQNILEIYKKN---KLEPNDISLNGGSHDA 573
            |.|  .:|....:..|.||          |..|.....|.|:.|.|   |...|.:         
 Worm   443 ENFDLDSTDSYYRIFQKLNRLRSEQQMEFIAGETPISPIKEVLKVNANYKRSKNAL--------- 498

  Fly   574 WAYPIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSITKS---FDE- 634
                   |:|...|..           |:|:...|.|::....|..||.||..|:..:   :|| 
 Worm   499 -------TVFAPFLDD-----------PFFDITYPDYVNLFFSGFLIAHEIGHSVDANGLGYDEN 545

  Fly   635 ----------------KAMRCVPHSVNIFSNY-------------SRMDILIHSGGMQISYHS-- 668
                            |..:|:   |:.:.||             |..:|:....|.::::.:  
 Worm   546 GKPMDGIRLEHVTEYGKQGQCL---VDQYDNYDDPVYGKKMNGTHSINEIIADWVGHEVTWRAYK 607

  Fly   669 ------MLSLTGPIKGMARLPGLNLTPTQIFFLVSAQELCAESNYLGID 711
                  ||||.|       |..:|:  .|::|.|.:...|.|.:.:.::
 Worm   608 KMDTSKMLSLIG-------LKDINM--DQLYFRVQSLLFCRERDTISLE 647

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 117/676 (17%)
nep-8NP_001309548.1 PepO 69..664 CDD:226118 119/684 (17%)
M13 76..664 CDD:189000 117/677 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.