DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-7

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_494534.2 Gene:nep-7 WormBaseID:WBGene00017552 Length:481 Species:Caenorhabditis elegans

Alignment Length:630 Identity:117/631 (19%)
Similarity:206/631 (33%) Gaps:227/631 (36%)


  Fly    71 NIENFNTRYNKNSIIGWICCAPCIWLRTSAAVHKMAITSATLLVTTLLVASPILFLISTAPSPLP 135
            |:|....:::.    .||                 |:....|:|...||...|...:...|..| 
 Worm     2 NVEKMREKFSS----PWI-----------------ALNLLLLMVFLALVTVHIKMTVEVKPVKL- 44

  Fly   136 RDCYMDGDRCSPAVSAPPECSDPICEAVASSIQARLNW---NKDPCTEFKKFSCWRNTPNKNITN 197
                  .:..|.|..:...|..|.|..::..:   ||:   :.|||.:|.:.:|.|         
 Worm    45 ------DELLSNAADSRNLCESPDCITLSHEL---LNYQDPSVDPCVDFFQHACGR--------- 91

  Fly   198 LIEMGNSQKSVDS---QMLYLFQNKIMNGSFGILHN--------------LFESC--LQQTTNST 243
                .:.|.||:|   :..|:.|.:|..    .|||              :|:.|  ||::.|: 
 Worm    92 ----FHEQSSVESRTQKKRYILQKQIRE----FLHNNKTSTSKSENLMKLVFDKCEALQKSQNT- 147

  Fly   244 VMHRIFDSLGGYLPVGSVGPSSIAPLIAKIYDLGPSPLVDLYHDLSYGRRPHILLIISGPSTSST 308
                      |||       ..:..:...|..:|..||:|...|.|                   
 Worm   148 ----------GYL-------QEVHEVFNDIKKIGAWPLLDKNWDES------------------- 176

  Fly   309 ILERKIRWMSPKAPPSRIRQGVPKLLADLIE-----------NFLPY----FVSYAQRVSEKDTI 358
                              :..:.::|.:|::           |||..    ||..|.  :||..:
 Worm   177 ------------------KFDLNEMLTNLVKLGATNFGLFQFNFLGLIMGNFVEIAP--TEKSDV 221

  Fly   359 FEFIKDLNKLQ---VEHSRRGFWDSTVLYNVSSLQDLYPV------LNWTLLIPQ----NWSGPI 410
            .|....|:.|:   :|..|...  |..|...|.|:....:      ::..|::|.    |:||.|
 Worm   222 EEIQMVLDILKGNGIEPDREEI--SRELEEYSMLEKKLKIVKENETISLNLILPDVRSVNFSGLI 284

  Fly   411 VVRNSDYLKALEYFLTKYPTRVAHNSLLLLSALQILPRDYPSP-EVCTRSTMWALPELSSSLYIA 474
            ...:             :|:||:..|.::..  :|:...:|.. |.....::.|:.|.:|:..:|
 Worm   285 AEMS-------------HPSRVSKLSGMITP--KIITNKHPLLFETNGTESLDAIIESTSNRTLA 334

  Fly   475 QH-------SSED-LKDTTKRAEIIFKSLKAHLKRAPSLKGAALVKLSALKIQSQTWEGFSNTTD 531
            .:       ||.| |.:|.:..|                     .|:.|:|:.....:.|.....
 Worm   335 NYLIFNYIQSSRDILTETYENCE---------------------QKVEAIKVIIGYPDHFDPPGT 378

  Fly   532 LLKSLQPLNITSECWFQNILE-------------IYKKNKLEPNDISLNGGSHDAWAYPIVSTIF 583
            |.|..:.:::.|...|..|.:             |..:..:.|.:..|...:|            
 Worm   379 LDKEFEHIDLDSTDSFYRISQKLHRLRTEQQMEFIAGETPISPVENVLEVSAH------------ 431

  Fly   584 YDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSI 628
            ||...:::......:..|:|:...|.|.:....|..||.||..|:
 Worm   432 YDPSKNALTFLAPFLDDPFFDTTYPDYANLFLSGRIIAHEIGHSV 476

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 98/523 (19%)
nep-7NP_494534.2 GluZincin 78..>477 CDD:301352 98/524 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.