DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-6

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_494537.1 Gene:nep-6 WormBaseID:WBGene00017550 Length:726 Species:Caenorhabditis elegans

Alignment Length:826 Identity:152/827 (18%)
Similarity:279/827 (34%) Gaps:276/827 (33%)


  Fly   100 AAVHKMA---ITSATLLVTTL--LVASPILFLISTAPSPLPRDCYMDGDRCSPAVSAPPE----- 154
            :|..|:|   |.....||.|:  |:|:.|:..::..|...||...:.....:|...:.||     
 Worm     2 SAKDKLANPLIALVVFLVLTIIALLATIIIMKLNEKPVEPPRVAPIAQKLVAPEKKSRPEPVTNP 66

  Fly   155 ------------------CSDPICEAVASSIQARLNW---NKDPCTEFKKFSCWRNTPNKNITNL 198
                              |..|.|..:|..:   ||:   :.|||.:|.|.:|.:.:.:      
 Worm    67 VTMTRPEPVTQASKPRNVCETPGCVTLADQL---LNFQDPSVDPCQDFYKAACGKYSEH------ 122

  Fly   199 IEMGN---SQKSVDSQML---YLFQNKIMNG-SFGILHNLFESC-------LQQTTNSTVMHRIF 249
             |:.|   .:|.:..|.:   :|.:|:.... |..::..::.:|       :......|....:|
 Worm   123 -EVANRRLQKKDIIIQRMIKNFLLKNETSESKSENVMRQVYRTCEGLKNEEIFNANMKTAFRELF 186

  Fly   250 ---DSLGGY------------------LPVGSVGPSSIAPLIAKIYDLGPS--PLVDLYHDLSYG 291
               ..:|.:                  |.:..:|.|:..     ::.:.|:  |.:::..|::  
 Worm   187 KDIQKIGSWPAADKNWDETKLNLNEMLLNIVKLGSSNFG-----LFQIRPTEVPFLEVAPDMA-- 244

  Fly   292 RRPHILLIISGPSTSST-------ILERKIRWMSPKAPPSRIRQGVPKLLADLIENFLPYFVSYA 349
                     ..|..|:.       |||:  ..:.|.          ..::||.:|::        
 Worm   245 ---------RSPKVSANFQQIIFDILEK--NGLQPD----------ENVIADDVEDY-------- 280

  Fly   350 QRVSEKDTIFEFIKDLNKLQVEHSRRGFWDSTVLYNVSSLQDLYPVLNWTLLIPQNWSGPIVVRN 414
              ::.::|:.::..|.|..:|:.|:              ||...|.|....:|.:       :.|
 Worm   281 --ITLEETLSQYAYDYNAEKVQFSK--------------LQAQVPSLKLEKIIEE-------MMN 322

  Fly   415 SDYLKALEYFLTKY-PTRVAHNSLLLLSA---LQILPRDYPSPEV-------------------- 455
            .:..|.|   :||. |..|||...|....   |:.|.:..|...:                    
 Worm   323 PNRKKLL---VTKVKPRMVAHKHSLFFDEKMNLEKLLKSTPKRTLANYLIFYYMDHAMNGLSVHD 384

  Fly   456 -------CTRSTMWALPELSSSLYIAQHSSE-DLKDTTKRAEIIFKSLKAHLKRAPSLKGAALVK 512
                   |.:..:..||:.|..:::..|..: :||...:.||...||....|:.:..| ||...|
 Worm   385 NVIKKRNCEKLVIEYLPKASLRVFVRNHFEKGNLKIVDEMAEETKKSFIEMLQESTWL-GADSKK 448

  Fly   513 LSALKIQSQTW-----EGFSNTTDLLKSLQPLNITSECWFQNILEIYKKNKLE----------PN 562
            .:.||::....     :.|.....|.|..:.|.:..:.....||:...:..:|          |.
 Worm   449 NAILKLEKMGKMIGYPKEFEKKGALDKMFETLKLLPKDTLYGILKKIGRFHMEQGIEFVALETPM 513

  Fly   563 DISLNGGSHDAWAYPIVST-IFYDTLSHSIVVPLSVIL----IPYFNAVLPPYLHYASVGVSIAK 622
            |..|          |::.| .||...:|     ||.::    .|.|:|..|.|::.|..|..:|.
 Worm   514 DPVL----------PVLMTNAFYTDRNH-----LSFLVGYMDDPLFDATYPKYVNIALTGNILAH 563

  Fly   623 EI----------------LRSITKSFD----EKAMRCVPHSVNIFSNYSRMDILIHSGGMQISYH 667
            |.                :||..|..|    .|..:|:....|.:.:......|..:..:.....
 Worm   564 ETSHGFDTAGIKRDENGEVRSWMKPEDLKEYGKKTQCLVDQYNEYDDPVFGKNLNGTTTLNEMVA 628

  Fly   668 SMLSLTGPIKGMARLPGL---------NLTPTQIFFLVSAQELCA----------------ESNY 707
            .|:.:|...|...:|...         |....:::|..:|.:.|:                ..|:
 Worm   629 DMIGVTVAWKVFEKLDSSKEQKVIGFENENIDKLYFRAAALDFCSLPPTTSLVEELTRVHPTGNF 693

  Fly   708 L--GIDTNAPEFDNILGWLVAQGGSATEVFKCPSGSMINVQKTCNV 751
            .  ||.:|.|:|             || .|.||.||.:|.:..|::
 Worm   694 RVNGIFSNMPQF-------------AT-AFNCPEGSPMNPKTRCSI 725

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 129/716 (18%)
nep-6NP_494537.1 M13 105..724 CDD:189000 130/718 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.