DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-21

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001343820.1 Gene:nep-21 WormBaseID:WBGene00011794 Length:856 Species:Caenorhabditis elegans

Alignment Length:838 Identity:157/839 (19%)
Similarity:272/839 (32%) Gaps:301/839 (36%)


  Fly   112 LLVTTLLVASPILFL-----------ISTAP-SPLPRDCYMDGDRCSPAVSAPPE------CSDP 158
            ||:|.||   .:|||           ....| .|||      .:..|.||....:      |:..
 Worm   121 LLITALL---SVLFLWLWVLDGYKTFTDGRPIYPLP------FENSSVAVDRSAKNHNDVVCTSR 176

  Fly   159 ICEAVASSIQARLNWNKDPCTEFKKFSCW-----RNTP-NKNITNLIEMGNSQKSVDSQMLYLFQ 217
            .|..:|..:...||...:||.:|.:|:|.     :|.| ||.:.:.|  .:.|..::.|:..:.|
 Worm   177 ECVRLAGFLAENLNSKINPCEDFYEFACGNYGLNKNLPANKPLRHTI--SDVQSRLNKQVKSMLQ 239

  Fly   218 ----------NKIMNGSFGILHNLFESCLQ----QTTNSTVMHRIFDSLGGYLPVGSVGPSSIAP 268
                      :|:..|       .::.||.    ::|....|..|...:||:             
 Worm   240 SPISANEKPWDKVAKG-------YYQKCLDEEELESTGVEAMRDIAKRIGGW------------- 284

  Fly   269 LIAKIYDLGPSPLVDLYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSRIRQGVPKL 333
                     |:...|.:.:.|:.....|.|:::....::.|||..:......:..|.|....||.
 Worm   285 ---------PTLEGDKWQEWSHSWEEQIALVLNLTGVNAVILEMAVTHDPSNSSRSVIELDQPKW 340

  Fly   334 LA------------DLIENFLPYFVSYAQRVSEKDTIFEFIKDLNK-LQVEHSRRGFWDSTVL-- 383
            .|            .::.|:.......|..:.....|.|  |::|: ::.|.....|....::  
 Worm   341 GAGSRYPYLSGANDPMLRNYTTLMKMTAVALGADPAIAE--KEMNEAMEFELKLVNFSADDMVRR 403

  Fly   384 --------YNVSSLQDLYPVLNWTL--------LIPQNWSGPIVVRNSDYLKALEYFLTKYPTRV 432
                    :.:..|:.::|.:|:..        |:..:.:..::||..||...:::.|...|.||
 Worm   404 DPERGNNRFELWQLKSVFPFINFEKYLKTVFKELVALSPNHTVIVREIDYFVGIQHVLQSTPKRV 468

  Fly   433 AHNSL---LLLSALQILPRDYPSP--------------------EVCT----------------- 457
            ..|.:   |:......||.....|                    |.|.                 
 Worm   469 LANYISWRLVQGFSPFLPPSAREPFYQFKANQTGMFNSPPPDRWEDCVTLSVIMMDMPVGRLFVE 533

  Fly   458 -----RSTMWALPELSSSL---YIAQHSSEDLKDTTKRAEIIFKSLKAHLKRAPSLKGAALVKLS 514
                 ...|..:.||:|.|   :|.|....|..|...|...|.|:.....|     .|..:|   
 Worm   534 NFFEKERAMKKMTELTSYLKNEFIKQLHVLDWMDEITRRRAISKANMIEYK-----SGFPMV--- 590

  Fly   515 ALKIQSQTW----------------------EGFSNTTDLLKSLQPLNITSECWFQNILEIYKKN 557
               :.:.||                      :....|.:||:..|||:  ...|||:..::    
 Worm   591 ---LFNDTWMEKNWGMIIKPREYLLHLTIRVKLVRFTEELLRLDQPLD--RSMWFQSPAQV---- 646

  Fly   558 KLEPNDISLNGGSHDAWAYPIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAK 622
                          ||         :|...::.::.|..::..|:....:|.|:.|..||..|..
 Worm   647 --------------DA---------YYAPNNNEMIFPAGIMQFPFLTLGVPNYITYGMVGAVIGH 688

  Fly   623 EILRSITKSFDEKA------------------------MRCVPHSVNIFSNYSRMDILIH----- 658
            |    ::.:||::.                        .||.   |..:.|...::..||     
 Worm   689 E----VSHAFDDQGGQYDEMGNLNDWWDAETEEKFIEKTRCF---VRQYENVHVVEADIHLNGQL 746

  Fly   659 --------SGGMQISYHSMLSLTGPIKGMAR--LPGL-NLTPTQIFFLVSAQELC---------- 702
                    :||::.::::..:......|::.  |||. |.|..|:|||..|...|          
 Worm   747 SLGENIADNGGVKTAFNAYKAWKSNTTGISEPALPGFQNFTSQQMFFLAYANNWCSLVRPKHYIQ 811

  Fly   703 -------AESNYLGID--TNAPEFDNILGWLVAQGGSATEVFKCPSGSMINVQKTCNV 751
                   |.|.|..:.  .|.|||              .:.|:||.||.:|.::.|.|
 Worm   812 IILTDVHAPSKYRAMIPLQNRPEF--------------AKAFQCPIGSPMNPERKCQV 855

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 135/753 (18%)
nep-21NP_001343820.1 M13 193..854 CDD:189000 136/755 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.