DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-23

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_503004.2 Gene:nep-23 WormBaseID:WBGene00013785 Length:714 Species:Caenorhabditis elegans

Alignment Length:751 Identity:145/752 (19%)
Similarity:243/752 (32%) Gaps:267/752 (36%)


  Fly   155 CSDPICEAVASSIQARLNWNKDPCTEFKKFSCWRNTPNKNITNLIEMGNSQKSVDSQMLYLFQNK 219
            |..|.|..:|..:....:.:.|||..|.:..|     .|...:.::.|.::|.:           
 Worm    76 CQTPECITLAHQLHNYHDPSADPCDNFYQSVC-----GKQHEHSLKSGLAKKHL----------- 124

  Fly   220 IMNGSFGILHNLFESCLQQTTNSTV---------MHRIFDSLGGYLPVGSVGPSSIAPLIAKIYD 275
                   ||.||....:   ||..|         |.:.......|....|   ||         |
 Worm   125 -------ILRNLIRETI---TNRKVTPTSKSENEMRKFHGICSKYQRANS---SS---------D 167

  Fly   276 LGPSPLVDLYHDL-SYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSRIRQGVPKLLADLIE 339
            :....|.|::.|: |.|         |.|:.|....|...              .:.::|.:|::
 Worm   168 IAQQALRDIFRDVQSIG---------SWPAGSRNWNESDF--------------NLNEMLNNLVK 209

  Fly   340 ----NFLPYFVSYAQR----VSEKD-------------TIFE----------FIKDLN---KLQV 370
                ||..:.:|:..|    :|.::             .|||          .:|||.   .|:.
 Worm   210 LGQRNFGLFQISFKYRDQLLISAEEHRRNYSKLEPTILNIFETNGLVPDRIQLLKDLEGFASLEA 274

  Fly   371 EHSRRGFWDSTVLYNVSSLQDLYP----------------------------VLNWTLLIPQNWS 407
            ......:.|:......:.|.||.|                            |||.||...:|.:
 Worm   275 LLKNHYYLDNMDKMKPAVLDDLVPSVDFMGLVKAMISPGKEHLMPKIELKTSVLNQTLFNDENMN 339

  Fly   408 GPIVVRNSDYLKALEYFLTKYPTRVAHNSLL---LLSALQILPRDYPSPE--VCTRSTMWALPEL 467
                         ||..:...|.|...|.|:   :.|:|..|..:..|.:  .|....:..||..
 Worm   340 -------------LEAIILDTPKRTLANYLIFNFIDSSLDHLVFETTSQKGNTCEDKVITYLPRA 391

  Fly   468 SSSLYIAQHSSEDLKD-TTKRAEIIFKSLKAHLKRAPSLKG----AALVKLSALKIQSQTWEGFS 527
            |..::|..:..::.:| .|:.||....:|...::.:..||.    .||.|::|:.......:.|.
 Worm   392 SLRVFIRNYVDKENRDLITQLAEKTRIALHTLVQNSTWLKAESKQLALDKINAMGKMIGYPDFFE 456

  Fly   528 NTTDLLKSLQPLNITSECWFQNILEIYKKNKLE---------------PNDISLNGGSHDAWAYP 577
            ....|....:.||:.|...:...|     ||||               |.|..|.....:|:.|.
 Worm   457 PPGTLDGMFKNLNLDSSDTYYTAL-----NKLERYFVEQKMDYFAEETPLDPDLRVFEMNAYYYI 516

  Fly   578 IVSTI-----FYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKE---------ILRSI 628
            ..:.:     |:|.              |.|::..|.|::.|..|..|..|         |||::
 Worm   517 PGNQLNFLAPFFDD--------------PMFDSTYPDYVNIAMSGNIIGHEMGHAFGPHAILRTV 567

  Fly   629 -----------TKSFDEKAMRCVPHSVNIFSNYSRMD-------------ILIHSGGMQISYHSM 669
                       ...::.:| :|:   .|.:|.|...|             ::..:.|.::|:...
 Worm   568 RGREVWMKPEELAEYESRA-QCL---ANQYSEYDDPDFGRVFDGGKVIDELVADNIGREVSWKMF 628

  Fly   670 LSLTGPIKGMARLPGL-NLTPTQIFFLVSAQELCA-----------ESNY-------LGIDTNAP 715
            .||  .:....|:.|. :....|::|.|.|...|.           ||::       .|:..|.|
 Worm   629 KSL--DLTNATRIIGFEDYDIDQLYFRVGALTHCTPHAMRDLKGSIESSHPRKAFRVNGVYANLP 691

  Fly   716 EFDNILGWLVAQGGSATEVFKCPSGSMINVQKTCNV 751
            ||              ...|.||:||.:|.:|.|::
 Worm   692 EF--------------ARAFNCPTGSPMNPRKKCDM 713

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 140/727 (19%)
nep-23NP_503004.2 M13 96..711 CDD:189000 140/728 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.