DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-16

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001023203.2 Gene:nep-16 WormBaseID:WBGene00018472 Length:868 Species:Caenorhabditis elegans

Alignment Length:647 Identity:127/648 (20%)
Similarity:245/648 (38%) Gaps:167/648 (26%)


  Fly    90 CAPC-IWLRTSAAVHKMAITSATLLVTTLLVASPILFLISTAPSPLPRDCYMDGDRCSPAVSAPP 153
            |:.| |||....|           |...|.:|..::::|:|           ||.|...|.|. .
 Worm   191 CSKCSIWLGALCA-----------LFFLLSIALFLVWVITT-----------DGFRTIGAKST-N 232

  Fly   154 ECSDPICEAVASSIQARLNWNKDPCTEFKKFSCWRNTPNKNITNLIEMGNSQKSVDSQMLYLFQN 218
            .|:...|..:|..:.:.::...:||..|.::||.|.             :|| :.|.||.:|.|.
 Worm   233 VCNTRQCIDIAFRLSSCIDDEIEPCENFYRYSCQRY-------------HSQ-TADKQMSFLSQL 283

  Fly   219 KIMNGSFGILHNLFES-----------CLQQTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLIAK 272
            |  :.|...:|:|..|           .|.::..|..|:.:..|        |..|:.:...| :
 Worm   284 K--DESLRRMHSLLSSEEDSRLLPKSARLSRSLYSACMNAVLRS--------SNAPTDLLTFI-R 337

  Fly   273 IYDLGP------------------SPLVD----LYHDLSYGRRPH------ILLIISGPSTSSTI 309
            .:..||                  :.::|    .|:.:.|.|..|      |:|.|..|..:..:
 Worm   338 NFPCGPLLRDCQNFHADSYSWERHAGMLDWYAGRYNLIVYDRDVHPQDRSKIILQIKPPDLTPIV 402

  Fly   310 --LERKIRWMSPKAPPSRIRQGVPKLLADLIENFLPYFVSYAQRVSEKDTIFEFIKDLNKLQVEH 372
              :||.:..::..:|    .:..|.|...|.:|.|..|.        :|::....:|:.. |::.
 Worm   403 GLIERDLIDLARPSP----TEFEPLLQLSLRQNLLSAFA--------RDSLLRDPRDVQS-QLDE 454

  Fly   373 SRRGFWDSTVLYNVSSLQDLYPVLNWTLL--------IPQ---------------NW--SGPIVV 412
            ..|...|   || :|:.|......|.|.:        :||               .|  :..:.:
 Worm   455 VARLMVD---LY-ISARQSASLTPNTTYMTIGEMFQALPQLYLREFLDAQLSNTYRWTETDMLSI 515

  Fly   413 RNSDYLKALEYFLTKYPTRVAHNSLLLLSALQI-----LPRD-YPSPEVCTRSTMWALPELSSSL 471
            ::.||...|...:.:...:...|.||.::...:     .||| |...|...:.:.:   |:...:
 Worm   516 QDYDYFARLSDIMAQTSRQAVANYLLTVTVWNLKQYSYSPRDQYGWRECVDQISSF---EIGRKM 577

  Fly   472 YIAQHSS----EDLKDTTKRAEIIFKSLKAHLKRAPSLKGAALVKLSALKIQSQTWEGF----SN 528
            |:.:.|.    ..:::..:..:|.|  |..|       :...|..||.:. :...:.||    .|
 Worm   578 YVDKASQTIDLPKIQEFLQNLKIDF--LSVH-------RSTPLQYLSNIN-RLGFYVGFPRRLQN 632

  Fly   529 TTDLLKSLQPLNITSECWFQNILEIYKKNK-LEPNDISLNGGSHDAWAYPIVS-TIFYDTLSHSI 591
            ...:.|.:..:::....:|.:::.:.|..: ...:.|.....:.|...:||.. |:.|::...:|
 Worm   633 EELIWKPVSQVSLNETDYFDSMIRVGKAERDYTMSQIGTYLDNDDTTTFPISDPTMLYNSNVGAI 697

  Fly   592 VVPLSVILIPYF--NAVLPPYLHYASVGVSIAKEILRSITKSFDEKA-MRCVPHSVNIFSNY 650
            |:||:.|..|.:  ...:|.|..|:|:|::..:.|.:...:..|:.: :.|:.   |:|..:
 Worm   698 VIPLAFIEPPIYLPGDEVPMYGIYSSLGITTLQMISKVFWQGLDKTSQLECLD---NVFRGF 756

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 108/561 (19%)
nep-16NP_001023203.2 GluZincin 254..>725 CDD:301352 102/526 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.