DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-17

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001254395.1 Gene:nep-17 WormBaseID:WBGene00010070 Length:1589 Species:Caenorhabditis elegans

Alignment Length:874 Identity:179/875 (20%)
Similarity:286/875 (33%) Gaps:296/875 (34%)


  Fly   104 KMAITSATLLVTTLL-VASP----ILFLISTAPS-----PLPRDCYMDGDRCSPAVS-------- 150
            :|..|.|..|...|: |.||    :|..|...|:     ..|...|...:.|:..||        
 Worm   779 QMPYTDAQFLRQILVDVHSPSIYRVLGTIQNFPAFKTAFNCPSSTYAPDNHCNVWVSDIDTTFGL 843

  Fly   151 --------APPECSDPICEAVASSIQA----------RLNWNKDPCTEFKKFSCWRNTPNKNITN 197
                    ..||.  ||.......:.|          .:|...|||.:|..::|           
 Worm   844 PNVKTDINVVPEA--PITSTNVDKMNAYQMAVDYYAKSVNTAIDPCDDFYSYAC----------- 895

  Fly   198 LIEMGNSQKSVD-----SQMLYLFQNKIMNGSFGILHN----------LFESCLQQTTNS----- 242
                ||..:||.     :|.|.....|:.:.::....|          |:.:||..|.:|     
 Worm   896 ----GNFNQSVSFYTARAQNLVYMAQKLEDPTYQTTINSSPALKKEKQLYNACLTATASSQSEDQ 956

  Fly   243 ----------------TVMHRIFDSLGGYLP-------VG-SVGPSSIAPLIAKIYDLGPSPLVD 283
                            |::.:.|..:.|..|       :| ::|..|....|    |...|||||
 Worm   957 ILISKNYIQTKVDDLKTLIGQDFTLVNGGAPKLPSAKQIGDALGYLSFEQGI----DTLISPLVD 1017

  Fly   284 LYH-DLSYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSRIRQG--------------VPKL 333
            .|. |.|.|   :.:.|....:..|....:...|...|  |..::..              :|..
 Worm  1018 TYWIDNSKG---YQMFIDQNTAYLSKTYYQPAAWKIEK--PKYLKMALDVVTRYAREQNITLPAG 1077

  Fly   334 LADLIENFLPYFVSYAQRVSEKDTIFEFIKDLNKLQVEHSRRGFWDSTVLYNVSSLQDLYPVLNW 398
            .:||:.|.|.|..:.|.:.|..|               ::||.|..|..|...|.|...|..::|
 Worm  1078 ASDLLSNVLDYEQNIAVKYSTDD---------------NTRRQFQRSWNLTKTSDLVTKYNFMDW 1127

  Fly   399 TLLIPQNWSGPIVVR---------------------NSDYLK----------------ALEYFLT 426
            ...:..   .|..|:                     ::|||:                ....::.
 Worm  1128 MTYLSH---APNAVKAKITDANYQVSVMEVDRLTHFSADYLQQSPELLVNLLFVRLLLGNAQYIP 1189

  Fly   427 KYPTR---VAHNSLLL-LSALQILPRDYPSPEVCTRSTMWALPELSSSL-----------YIAQH 476
            .|.:.   :...|:.| ||..:.:|...|.|.....:...|...::::|           |: ..
 Worm  1190 SYASAFRGMTDESIFLGLSRRKTIPNHIPPPNFDLEANGPACASVANNLMQFANGRVFVDYM-YP 1253

  Fly   477 SSEDLKDTTKRAEIIFKSLKAHLK--------RAPSLKGAALVKLSALKIQSQ----TWEGFSNT 529
            :::|:.:..|.|..|.|::.:..:        .||..|..|..|  .::||..    .|  ..|.
 Worm  1254 TAQDVTNIRKSAGGIIKNVISSFQGMIDQLDWMAPDTKQKAYAK--TVQIQQNIAFPDW--IKND 1314

  Fly   530 TDLLKSLQPLNITSECWFQNILEIYKK----------NKL-----EPNDISLNGGSHDAWAYPIV 579
            |.|......|.|...   .|..:||.|          |:|     :..|.....|:.:||..|.:
 Worm  1315 TLLGNYYSTLVIADS---DNFYDIYDKLIKFNIFVQYNQLNAAQTDRTDFLGQPGTVNAWYQPEL 1376

  Fly   580 STIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSITKSFDEKAMRCVP--- 641
                     :||..|..:::.||||...||.::|..:|:....|    :|..||::.::..|   
 Worm  1377 ---------NSITFPAGILVPPYFNPNWPPSINYGGMGLVAGHE----LTHGFDDQGVQWGPTGN 1428

  Fly   642 -------HSVNIFSNYSRMDILIHSG--------------------GMQI-----------SYHS 668
                   :|:..|.|.|:..|..:||                    |..|           :|.:
 Worm  1429 LARWMDDNSMAGFKNMSQCVINEYSGFCPLNATNYSPNCVKGPQTQGENIADNGGVHAAFNAYKT 1493

  Fly   669 MLSLTGPIKGMARLPGL---NLTPTQIFFLVSAQELC-------AESNYLGIDTNAPEFDNILGW 723
            ..||.||   ..|||..   ..|..|:||:..||..|       |....:.:|.::|....:.|.
 Worm  1494 HQSLDGP---DPRLPDRLFGQFTHDQLFFMSFAQVWCEVRRTDDALYTQIMVDPHSPSMYRVYGT 1555

  Fly   724 LVAQGGSATE-VFKCPSGSMINVQKTCNV 751
            :  |...|.: .|.||.||....::.|.|
 Worm  1556 I--QNFPAFQTAFNCPLGSKSAPEQHCEV 1582

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 155/763 (20%)
nep-17NP_001254395.1 PepO 108..833 CDD:226118 14/54 (26%)
M13 112..830 CDD:189000 13/51 (25%)
PepO 880..1583 CDD:226118 158/772 (20%)
M13 884..1581 CDD:189000 156/765 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.