DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-1

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_496490.2 Gene:nep-1 WormBaseID:WBGene00013926 Length:754 Species:Caenorhabditis elegans

Alignment Length:802 Identity:172/803 (21%)
Similarity:298/803 (37%) Gaps:228/803 (28%)


  Fly   122 PILFLIST-------APSPLPRDCYMDGD-RCSPAVSAPPECSDPICE------AVASS------ 166
            ||:||||.       ....|||..|.:.| ..:...|......:.:.|      .|..|      
 Worm     8 PIVFLISCYALILCGTVDALPRAPYFNDDINKTTTTSEDKTVGNTVVEEEKKTYTVGDSEGYQEA 72

  Fly   167 ---IQARLNWNKDPCTEFKKFSC--WRNT---PNKNITNLIEMGNSQKSVDSQMLYLFQNKI--- 220
               :|..||.:.|||.:|.:::|  |.::   |: ::|:..:...:::.|.::|..|:::..   
 Worm    73 SRLLQKSLNLSLDPCDDFFEYACRAWVDSHPIPD-DLTSYSQFTATREKVLAEMRKLYEDNTSIP 136

  Fly   221 MNGSFGILHNLFESCLQQTTNSTVMHR-IFDSLG--GYLPV--GSVGPSSIAPL----------- 269
            .:.|..::..::.:|:....::.|..| :.:.:.  ||.|:  ......|...|           
 Worm   137 TSKSIALIKQIYNTCMDTEKHNAVGARDLLEKIKTYGYWPMVHNEKWRESTFDLTKLLSNTIQSR 201

  Fly   270 -IAKIYDLGPSPLVDLYHDLSYGRRPHILLIIS------GPSTSSTILERKIRWMSPKA----PP 323
             ::..:|.||:.     ...:..||   ||...      |.||....|:.|......||    ..
 Worm   202 DVSVFFDFGPAE-----DSRNVSRR---LLSFDQGSLGLGYSTRDYYLDEKKYEKQMKAYRKYTI 258

  Fly   324 SRIRQGVPKLLADLIENFLPYF-------VSYAQRVSEKDTIFEFIKDLNKLQV-EHSRRGFWDS 380
            .::|                |:       |:.::..|:.|.|..|.|:..::.| |..||.:   
 Worm   259 GKVR----------------YYTEDAGMAVNESKIESDVDEIIAFEKEWAQILVAEEDRRNY--- 304

  Fly   381 TVLYNVSSLQDL---YPVLNWTLL------------IPQNWSGPIVVRNSDYLKALEYFLTKYPT 430
            |.||||....||   ..:::|..|            :..|.|  |::.:.:||:.:...|.....
 Worm   305 TKLYNVRRFDDLKEYMSIIDWKKLTLSTTPFLVHSYLKTNPS--IIISDVEYLQKMNTLLQNTDP 367

  Fly   431 RVAHNSLLLL-------------------SALQILPRDYPSP--EVCTRSTMWALPELSSSLYIA 474
            |:..|.:||.                   .|.|:..|....|  :.|..|....|...|.|:|:.
 Worm   368 RIVTNYILLRWAGSWSQEIGKKYEDLQQEFAFQMYGRKQRQPRWKDCVSSAGGKLSYASGSMYVR 432

  Fly   475 QHSSEDLKDTTKRAEII------FKS-------LKAHLKRAPSLKGAALVK--------LSALKI 518
            ::...:.|:||  .::|      |::       :.|..|:....|...::|        |:..|:
 Worm   433 KYFDANAKNTT--LDMITDLQEAFRNMMHANDWMDAETKKYALEKADQMLKQIGYPDFILNDEKL 495

  Fly   519 QSQTW---------EGFSNTTDLLKSLQPLNITSECWFQNILEIYKKNKLEP-NDISLNGGSHDA 573
            ..  |         :.||...:  ||:|        |..|   .|.:..||| |.......:   
 Worm   496 DD--WYKGLEGAPEDSFSQLVE--KSIQ--------WRNN---FYYRRLLEPVNRFEFISSA--- 542

  Fly   574 WAYPIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEI-------------- 624
                .|...||....::|..|..::..|:|:|..|..|:|..:|..|..||              
 Worm   543 ----AVVNAFYSPTRNAIAFPAGILQQPFFDARFPKALNYGGIGAVIGHEITHGFDDTGRQFDNV 603

  Fly   625 --LR-----SITKSFDEKAMRCVPH----------SVNIFSNYSRMDILIHSGGMQISYHSMLSL 672
              ||     :.:..|:|:. :|:..          .:.|....::.:.:..:||::.::.:..|.
 Worm   604 GNLRDWWDNTTSSKFNERT-QCIIEQYADVKLRGTDLRINGKLTQGENIADNGGIKQAFKAYKSY 667

  Fly   673 TGPIKGM-ARLPGL-NLTPTQIFFLVSAQELC------AESNYLGIDTNAPEFDNILGWLVAQGG 729
            .....|. ||||.. :||..|:||:..||..|      .::..|..|.::||...:...|..|..
 Worm   668 LEKHGGQEARLPQFESLTNEQLFFVGYAQVWCGAKTPETKTLLLLTDPHSPETARVNTVLTNQPE 732

  Fly   730 SATEVFKCPSGSMINVQKTCNV 751
            .| |.||||:||.:|..|.|.|
 Worm   733 FA-EAFKCPAGSPMNPTKRCVV 753

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 152/722 (21%)
nep-1NP_496490.2 PepO 80..754 CDD:226118 156/731 (21%)
M13 85..751 CDD:189000 152/722 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.