DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-26

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001022540.1 Gene:nep-26 WormBaseID:WBGene00014171 Length:807 Species:Caenorhabditis elegans

Alignment Length:863 Identity:164/864 (19%)
Similarity:291/864 (34%) Gaps:326/864 (38%)


  Fly    99 SAAVHKMAITSAT---LLVTTLLVASPILFLISTAPSPLPRDCYMDGDRCSPAVSAPPECSDPIC 160
            |::..|.||:|::   ||:|.|     ::||..|....:....|..        :.|  |:...|
 Worm    60 SSSRSKEAISSSSKGCLLLTVL-----VIFLFVTLSFAIACFLYYQ--------TLP--CTSEEC 109

  Fly   161 EAVASSIQARLNWNKDPCTEFKKFSC--WRN-TPNKNITNLIEMGNSQKSVDSQMLYLFQNKIMN 222
            ...||.:..|::.:.:||..|.:|:|  |.| :.|....:...:..:|::...|::.. .:||.:
 Worm   110 VMTASRLLKRVDQSVEPCDNFYQFACGGWINQSVNLKYDSWNTLYETQRTAHDQIVQA-MHKIND 173

  Fly   223 GSFGILHN--------LFESCLQ-QTTNSTVMH---RIFDSLGGYLP------------------ 257
            ||:.:..|        ::|.|:. .|...|.:|   |..|.|||::|                  
 Worm   174 GSYPLPTNAGERAAAKMYEQCMDTDTLEQTGLHLWERFVDELGGWMPELKNGALEQEESFEIELD 238

  Fly   258 --------------VGSVGPSSIAPL---------------IAKIYDLGPSPLV-DLYH------ 286
                          :.|....|:.||               :..||:..|..|. :.||      
 Worm   239 EDEKKRRRFEIEDIILSAFNYSVFPLFWAGVEVNYLNSKEHLITIYEQLPILLAPEKYHYNKELT 303

  Fly   287 -DLSYGRRPHILLIISGPSTS----------STIL-----ERKIRWMSPKAPPSRIRQGVPKLLA 335
             ::.||:       :.||..:          |.:|     :.|:|.|                :|
 Worm   304 PEMIYGK-------MEGPPVTRALQQVGEELSAVLGFDSTDEKVRMM----------------IA 345

  Fly   336 DLIENFLPYFVSYAQRVSEKDTIFEFIKDLNKLQVEHSRRGFWDSTVLYNVSSLQDLYPVLNW-- 398
            ::|  :|.|.::.|.....|:....:                   ||:. :..||::.|.:||  
 Worm   346 NMI--YLEYQITMAGSTFYKEKKERY-------------------TVVM-LRELQEIAPAINWHY 388

  Fly   399 ---------------------TLLIP----------QNWSGPIVVRNSDYLKALEYFLTKYPTRV 432
                                 |..||          |:.||..|::|          ..|:.|.:
 Worm   389 FLSRLVGENLSHSEPIALKTGTQWIPILSAIVEKLKQSRSGVAVLKN----------YVKWKTIM 443

  Fly   433 AHNSLLLLSALQILPRDYPSPEVCTRSTMWALPELSSSLYIAQHSSEDLKDTTKRAEIIFKSLKA 497
            .|.:             |.||: |....:|    ::.|||....|........:.:.|...||.:
 Worm   444 FHLA-------------YASPK-CRDGLLW----MAVSLYSGAASQRKEFCVLRLSGIFPLSLPS 490

  Fly   498 HLKRAPSL----KGAALVKLSALKIQSQTWEGFSNTTDLLKSLQPL--------NITSECWFQNI 550
            .|::...:    |....|:..|.:|| :.:|....:::|....:..        |:|....|.:.
 Worm   491 ILRKIDGIDHTEKNVKAVQNIADRIQ-EKYEEMVRSSNLFSDRETRENVIDKVNNMTKFIGFPDA 554

  Fly   551 LEIYKKNKLEPNDISLNGGSHDA--WAYPIVSTIFY-----------------DTL------SHS 590
            :.  ...::|...:.|    ||.  |:..:.|:..|                 ||.      :|:
 Worm   555 MR--SDYEMEKEAVRL----HDTLFWSMVLGSSSVYKERLQRLRLPVDPRSWVDTRPAISVPAHN 613

  Fly   591 -----IVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSITKSFDEKAMRCVP--------- 641
                 :.:|...:.:||.:.....:.:||.:|..|..|    :|.:||.:.....|         
 Worm   614 YERNLVQIPFDSLRLPYADEHQLDFANYAGIGTIIGHE----LTHAFDGQGKLHGPTGNLGVWWS 674

  Fly   642 -HSVNIFSNYSRMDILIHSG----------------------GMQISYHSMLSLTGPIKGMARLP 683
             .|:..|....:..:..::|                      |::::|.:..|......|  |:|
 Worm   675 TDSIREFKAREQCFVKQYAGLMDSHDMNAAKEGLYENIADQVGLKVAYEAWKSNGNQNSG--RMP 737

  Fly   684 GL-NLTPTQIFFLVSAQELCA--ESNY------------LGIDTNAPEFDNILGWLVAQGGSATE 733
            || ..:..|:|||...|..||  ..:|            ||...|:|||              ..
 Worm   738 GLEKYSQDQLFFLAYTQGWCALRSKSYKLQPHMEERIRMLGSLQNSPEF--------------AS 788

  Fly   734 VFKCPSGSMINVQKTCNV 751
            .:||.|.|.:|....|::
 Worm   789 AWKCSSESFMNPPDKCSI 806

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 144/780 (18%)
nep-26NP_001022540.1 PepO 111..807 CDD:226118 148/798 (19%)
M13 124..805 CDD:189000 145/782 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.