DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-12

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_494857.2 Gene:nep-12 WormBaseID:WBGene00017842 Length:734 Species:Caenorhabditis elegans

Alignment Length:882 Identity:166/883 (19%)
Similarity:290/883 (33%) Gaps:337/883 (38%)


  Fly    58 MGKSDEIEMIDSANIENFNTRYNKNSIIGWICCAPCIWLRTSAAVHKMAITSATLLVTTLLVASP 122
            |.|..:..||| .:|.....|..||:                    ::|...|.|.:.|||::..
 Worm     1 MNKKSKTVMID-YSITKILERNKKNA--------------------RLAAVFAALFILTLLISIS 44

  Fly   123 ILFLISTAPSPLPRDCYMDGDRCSPAVSAPPECSD-------------------------PICEA 162
            .:.:::..           .|..|..:|....||:                         |.|..
 Worm    45 FITIVAIL-----------SDGFSTLISGSELCSNTEGDAYEVKNSNHVNYGSDNSTCLTPECIR 98

  Fly   163 VASSIQARLNWNKDPCTEFKKFSCWRNTP-------NKNITNLIEMGNSQKSVDSQMLYLFQNKI 220
            :|:|....:|.:.:||.:|.:|:|.:...       .|.:|.|.||   :|.:|..:..:.:...
 Worm    99 LAASYLNNMNRDANPCEDFYEFACGKYATRKVIAEHEKKVTVLSEM---KKEMDRHLKDILEKTS 160

  Fly   221 MNG---SFGILHNLFESCLQQTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLIAKIYDLGPSPL- 281
            ...   |..:....|:||:.:.:.        |.||            :.||::.|.:||..|| 
 Worm   161 RENTTRSMKLAQIYFDSCMDEFSQ--------DDLG------------VQPLMSMISNLGGWPLL 205

  Fly   282 -------VDLYHDLSYGRRPHI-----------------------LLIISGPSTSSTILERKIRW 316
                   :|...::..|   |:                       :|:.|.|   ...||:|..:
 Worm   206 TNARFDSIDFQWEVLAG---HLALYGVDGIFRVFVHSSFDDSDKNVLMFSPP---KLFLEKKKFY 264

  Fly   317 MSPKAPPSRI-----RQGVPKLLA----------DLIENFLPYFVSYAQRVSEKDTIFEFIKDLN 366
            .  :.|.|.:     ||.:..||:          .:||..:...:.:.:|::            |
 Worm   265 R--EVPSSNVYLQYYRQYILSLLSLLGVDMEDETGVIEYQVDDIIDFERRIA------------N 315

  Fly   367 KLQVEHSRRGFWDSTVLYNVSSLQDL---------YPVLNWTLLIPQNWSG---------PIVVR 413
            ..::|.||          |.||:.::         |..:||.....:...|         .|.|.
 Worm   316 LTRIELSR----------NHSSINNMITFGEFKRKYDKINWDAFFNEEMRGNLGRMPDSLVINVV 370

  Fly   414 NSDYLKALEYFLTKYPTRVAHNSLL--LLSALQI-LPRDYPSPEVCTRSTMWALP---------- 465
            :.:|...|...:...|....:|.|:  |:|...: ||..|..|.:..|..|:.:.          
 Worm   371 DVNYFDNLYSLIKSKPLSSINNFLMWCLVSNYDMYLPAKYRKPMLDFRQKMYGVSSDDPLWEVCV 435

  Fly   466 -ELSSSLYIAQHSSEDLKDTTKRAEIIFKSLKAHLKRA------------PSLKGAALVKLSAL- 516
             |:..:|.:...:....|..||:.:::.:.:...||:|            .|.:.|||:||.|: 
 Worm   436 GEVRENLAMPLSTEYAQKFFTKKDKLVAEDMIRDLKKAMEQTLLNADWIDESTREAALMKLDAMG 500

  Fly   517 -KIQSQTWEGFSNTTDLLKSLQPLNITSECWFQNILEIYKKNKLEPNDISLNGGSHDAWAYPIVS 580
             ||..              :|..|:.|                  |:.|.        ||.||::
 Worm   501 HKIGD--------------ALSKLHRT------------------PSLID--------WASPIIA 525

  Fly   581 T-IFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSITKSFD----------- 633
            . .|:....:.|:.|..::..|.|....|.:.:|.::|:.|..|    ||..:|           
 Worm   526 VDAFHYFTGNEIIFPAGILQFPMFVPDAPAFSNYGAIGMGIGHE----ITHGYDDLGAQYDDKGN 586

  Fly   634 -------------EKAMRC----------------VPHSVNIFSNYSRMDILIHSGGMQISYHSM 669
                         :|..:|                |...:.|..|      :..:||:::::.:.
 Worm   587 LRGWWHTETMTTFQKKKQCFVAQYGSKIEPQTGRKVDGKMTIGEN------IADNGGLRVAFQAY 645

  Fly   670 LSLTGPIKGMARLPGL-NLTPTQIFFLVSAQELCAESNYLGID-------------------TNA 714
            ...:...|...||||| :.:|.|:|||..|...|.......||                   .|.
 Worm   646 QLRSDREKETRRLPGLTDFSPNQLFFLAYANTWCEALKPSAIDHIMDTDVHSLGMFRVNVPLQNL 710

  Fly   715 PEFDNILGWLVAQGGSATEVFKCPSGSMINVQKTCNV 751
            |.|              ::.|.||.||.:|..:.|.:
 Worm   711 PAF--------------SKEFDCPIGSPMNPFEKCRI 733

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 140/736 (19%)
nep-12NP_494857.2 PepO 104..734 CDD:226118 142/748 (19%)
M13 111..732 CDD:189000 141/738 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.