DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-3

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_494679.2 Gene:nep-3 WormBaseID:WBGene00016778 Length:634 Species:Caenorhabditis elegans

Alignment Length:751 Identity:138/752 (18%)
Similarity:263/752 (35%) Gaps:236/752 (31%)


  Fly   107 ITSATLLVTTLLVASPILFLI-----------------STAPSPLPRDCYMDGDRCSPAVSAPPE 154
            :|...:|...::|..|::.|:                 :::.||.|:                |.
 Worm    13 VTVIIILAVPIIVILPLVLLLEAGKIGGEVSENCSNHSTSSASPKPK----------------PM 61

  Fly   155 CSDPICEAVASSIQARLNW---NKDPCTEFKKFSCWRNTPNKNITNLIEMGNSQKSVDSQML--- 213
            |..|.|..:...:   ||:   :.|||..|.:.:|.:    .|..|:|:  .|:.:...|::   
 Worm    62 CLTPECITLVHQL---LNFQDPSVDPCENFYQAACGK----YNEHNVID--GSRTAQKQQIVKRL 117

  Fly   214 ---YLFQNKIMNG-SFGILHNLFESCLQQTT-----NSTVMHRIFDSLGGYLPVGSVGPSSIAPL 269
               :|.:|:.... |...:..|:|.|.:..|     |..::..||                    
 Worm   118 IRDFLHKNQSSTSKSENSMKLLYEKCKEAKTIKVLGNQNLLQEIF-------------------- 162

  Fly   270 IAKIYDLGPSPLVDLYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSRIRQGVPKLL 334
             ..|..:|..|::|...|   |::.::         :..:|             |.||.||    
 Worm   163 -MNIQKIGSWPVLDENWD---GKKFNL---------NEMLL-------------SLIRLGV---- 197

  Fly   335 ADLIENFLPYFVSYAQRVSEKDTIFEFIKDLNKLQVEHSRRGFWDSTVLYNVSSLQDLYPVLNWT 399
                .||     .:.:.:...|...|         ::.:|          |..:.::|..:::..
 Worm   198 ----SNF-----GFFEIIISSDAFVE---------IKPAR----------NFPTRENLSDIISKV 234

  Fly   400 LLIPQNWSGPIV--VRNS--DY------LKALEYFLTKYPTRVAHNSLLL--LSALQILPRDYPS 452
            .|  .|...|.:  :.|.  :|      ||:||..:...|.|...|.|:.  |.::.:..:..|.
 Worm   235 FL--GNGFQPNITAIENDLREYENLQRELKSLERLIQTTPNRSLVNYLIFNYLKSVMLEYKRLPE 297

  Fly   453 PEVCTRSTMWALPELSSSLYIAQH-SSEDLKDTTKRAEIIFKSLKAHLKRAPSL----KGAALVK 512
             |.|....:..||..|:.:::... ..|:.|......|.:.......::.:..|    |..|:.|
 Worm   298 -EQCEGVVIDFLPRASTRVFVQNFLDKENRKYVAGMIEDVKMGFIDMIQESTWLNEESKKVAVQK 361

  Fly   513 LSALKIQSQTWEGFSNTTDLLKSLQPLNITSECWFQNILEIYKKNKLE------PNDISLNGGSH 571
            :..:|......:.|.....|.:|.:.|||.....:..|:...:|...|      .::|.|:.   
 Worm   362 VKNIKSMIGYPDFFEPPGTLDRSFKDLNIEQTDSYHTIVRKIQKFTNEQCMEFVASEIPLDP--- 423

  Fly   572 DAWAYPIV-STIFYDTLSH-SIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSITK---S 631
               ..||: :..||...:. :|:.|  |:..|.|:...|.|::.|.:|..:|.||..:...   :
 Worm   424 ---RQPILHANAFYQNTNFLAILAP--VLDDPIFDTTFPRYVNLAVIGNVLAHEIGHAFDHTGIN 483

  Fly   632 FDE-----------------KAMRCV--PHSV--------NIFSNYSRMDILIHSGGMQISYHSM 669
            :|:                 |.:||:  .|..        |:..:.:..:|.....|::.::.:.
 Worm   484 YDDAGQQRIWLTPEDSEEYGKRLRCLLRQHDEYDDPDFGRNLNGSKTLHEISADRFGVEAAWRTF 548

  Fly   670 LSLTGPIKGMARLPGL-NLTPTQIFFLVSAQELCAE----------------SNYL--GIDTNAP 715
            ..|  .:...:.:.|. |....|::|..:|...|.:                :|:.  ||..|.|
 Worm   549 KKL--DLSNESEIVGFQNFNIDQLYFRTAALIWCRQRDTTDLQYALQREHPTNNFRVNGIYANMP 611

  Fly   716 EFDNILGWLVAQGGSATEVFKCPSGSMINVQKTCNV 751
            :|              .|.|.||.||.:|.:|.|::
 Worm   612 QF--------------AETFNCPLGSPMNPKKKCDL 633

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 123/659 (19%)
nep-3NP_494679.2 M13 82..631 CDD:189000 123/660 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.