DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-10

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_494532.2 Gene:nep-10 WormBaseID:WBGene00017555 Length:711 Species:Caenorhabditis elegans

Alignment Length:794 Identity:151/795 (19%)
Similarity:275/795 (35%) Gaps:249/795 (31%)


  Fly   106 AITSATLLVTTLLVASPILFLISTAP-----SPLPRDCYMDGDRCSPA--------VSAPPE-CS 156
            |:....|:|...||...|...|..||     .||||.   |.|: .||        |..|.. |.
 Worm    18 ALNLLLLIVFLALVTVHIKMTIDVAPVFKSDDPLPRG---DPDQ-KPATIDSETQTVDEPRNVCE 78

  Fly   157 DPICEAVASSIQARLNWNKDPCTEFKKFSCWRNTPNKNITNLIEMGN--SQKSVDSQML--YLFQ 217
            .|.|..:|..:....:.:.|||.:|.:..|.:...:    :.|..|.  :::|..|:::  :|.:
 Worm    79 SPECITLAHELHNYKDPSVDPCQDFYQHFCGKFYEH----SAIGQGRMATKRSTLSKLIREFLLK 139

  Fly   218 NKIMNG-SFGILHNLFESCLQQTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLIAKIYDLGPSPL 281
            ||.... |...:..::..|.:       :.:|.|       :.|:.|.::..:.:.|..:|..|:
 Worm   140 NKTSTSKSENTMKQVYAKCRE-------LQKISD-------LNSIPPQALLDIFSDIKKIGAWPV 190

  Fly   282 VD--------------------------LYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPK 320
            :|                          .:| ..:..||::|:                      
 Worm   191 LDKDWDGSKFNLNEMLRQLVNLGETHLGFFH-FDFIARPYVLI---------------------- 232

  Fly   321 APPSRIRQGVPKLLADLIENFL--PYFVSYAQRVSEK-DTIFEFIKDLNKLQVEHSRRGFWDSTV 382
            .||  ::|||.|.:.:.:...:  ...:...|..||. |..||.   .|:::::...|     |.
 Worm   233 KPP--LKQGVQKSVLEKVVKMILEANEIKMDQGFSEDLDEYFEL---SNRIKIDKLPR-----TS 287

  Fly   383 LYNVSSLQDLYPVLNWTLLI----PQN---------------WSGPIVVRNSDYLKALEYFLTKY 428
            ...|..|.|:..: |:..||    |::               :..|:.||::: ...|:..:...
 Worm   288 RSIVGLLPDVRRI-NFRGLILEMMPRSKMNRFLGTLFQKVVTYHHPLFVRDNE-TNHLDTIIRST 350

  Fly   429 PTRVAHNSLL---LLSALQILPRDYPSP-EVCTRSTMWALPELSSSLYIAQ-----HSSEDLKDT 484
            ..|...|.|:   :.|:::.|.....|. |.|.:..:..||..|..:::..     :..|..|.|
 Worm   351 SNRALANYLIFNFIHSSIKFLTFGLKSDRERCEKIVVQELPRPSLRVFMRNCVDKGNREEVAKLT 415

  Fly   485 TKRAEIIFKSLKAHLKRAPSLKGAALVKLSAL------------------KIQSQTWEGFSNTTD 531
            ....|.:.:.::......||:|...|.|:.|:                  :.::.|.:...:...
 Worm   416 ETVKENVLEMIRESDSFTPSVKKRVLKKVEAIGAIIGYPDHFDPPGTLDKEYENLTLDASDSYYK 480

  Fly   532 LLKSLQPLNITSECWFQNILEIYKKNKLEPNDISLNGGSHDAWAYPIVSTIFYDTLSHSIVVPLS 596
            :.:.|..|.:..:..|     :..:..|.|:|..|...:|            ||:..:::.|...
 Worm   481 MSQKLHQLRLQHQMEF-----LAGQTPLSPSDQVLEVNAH------------YDSKDNALTVLAP 528

  Fly   597 VILIPYFNAVLPPYLHYASVGVSIAKEILRSI------------TKSFDE--KAMRCVPHSVNIF 647
            .:..|:|::..|.|::....|..|..|...||            |:...|  |..:|:   ::.:
 Worm   529 FLDDPFFDSTYPEYVNLIFTGFLIGHEFGHSIDPKILRRDGWYKTEDMTEYGKRAQCL---IDQY 590

  Fly   648 SNYSRMDILIHSGGMQISYHSMLSLTGPIKG-------------------MARLPGL---NLTPT 690
            .||...|   |...|..:|     ..|.|.|                   |.:|.|.   ||  .
 Worm   591 DNYDDPD---HGKQMNGTY-----CIGEIVGDWVGRDVTWRAFKKMDLSKMQKLIGFEDKNL--D 645

  Fly   691 QIFFLVSAQELCAESNYL------------------GIDTNAPEFDNILGWLVAQGGSATEVFKC 737
            |::|.:.:...|...:..                  ||.:|.|:|              .:.|.|
 Worm   646 QLYFRIQSLFFCGPRSMKSLEQLLSDPHPTEVFRVNGIYSNMPQF--------------AKAFNC 696

  Fly   738 PSGSMINVQKTCNV 751
            |.||.:|.:|.|.:
 Worm   697 PIGSPMNPEKKCKM 710

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 127/707 (18%)
nep-10NP_494532.2 M13 97..709 CDD:189000 128/709 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.