DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-9

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_494531.2 Gene:nep-9 WormBaseID:WBGene00017554 Length:700 Species:Caenorhabditis elegans

Alignment Length:708 Identity:124/709 (17%)
Similarity:249/709 (35%) Gaps:177/709 (25%)


  Fly   152 PPECSDPICEAVASSIQARLNWNKDPCTEFKKFSC-----------WRNTPNKNITNLIEMGNSQ 205
            |..|..|.|..:|..::|..:.....|.:|.|.:|           .|:...:...|.:..|..|
 Worm    61 PQFCESPQCIILAQELKAYSDTATKSCEDFYKATCENYKDHQALDRHRDCKKRKAVNKLVRGFLQ 125

  Fly   206 KSVDSQMLYLFQNKIMNGSFGILHNLFESCLQQTTNSTVMHRIFDSLG--GYLPV----GSVGPS 264
            :.         ::...:.|...:..:|..|.:.:.|::.:. ||..:.  |..||    ......
 Worm   126 RD---------ESTFTSESESAIKLIFGKCDELSRNTSYLD-IFKDIKKIGSWPVLEHNWKDSMF 180

  Fly   265 SIAPLIAKIYDLGPSPL----VDLYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSR 325
            ::..:|||:..||.:..    ::| ..|::|   |..:.:|...      |:.|..:........
 Worm   181 NLDDVIAKLVKLGSTDFGLFKLEL-RKLAFG---HFAVFVSSKQ------EQNIHQLEKTILGIL 235

  Fly   326 IRQGVPKLLADLIENFLPY--FVSYAQRVSEKDTIFEFIKDLNKLQVEHSRRGFWDSTVLYN--V 386
            ...|:.:...:|.::...|  |.::.:...:::|..|:              ..:..:::.|  :
 Worm   236 KANGIQQDRKELSDDLKDYSDFKNHLKEFYQEETYIEY--------------RLYAGSIVENLGI 286

  Fly   387 SSLQDLYPVLNWTLLIPQNWSGPIVVRNSDYL----KALEYFLTKYPTRVAHNSLLLLSALQILP 447
            |||.....:.:..|.:..:.:...::.||...    ..|...:.|.|.|...| .|:...:.::.
 Worm   287 SSLTTQMALKSTGLDVFNHVNQRTLITNSSLFFGEENNLGMIIQKTPKRTLAN-FLIFHFIDVMT 350

  Fly   448 RDYP-SPEVCTRSTMWALPELSSSLYIAQHSSEDLKD---------TTKRAEIIFKS---LKAHL 499
            .|.. :.:.|..:.:..||..|..:......:||.:|         .||..|:|..|   .|.||
 Worm   351 TDLANATKACKETLIDLLPRASIQVLSRNFVNEDAQDDMVKMAQDLKTKITEMIDNSPFFTKFHL 415

  Fly   500 --------KRAPSLKGAALVKLSALKIQSQTWEGFSNT--TDLLKSLQPL-NITSECWFQNILEI 553
                    |....:|...:|.....::..:.:|..:.|  ..:.:::|.| .:.||...:::   
 Worm   416 VFDAEEQKKLIQKVKAIGIVTEYPQEVLDRDFERLNLTPSDSIYRTIQKLRRLRSEQLIEHL--- 477

  Fly   554 YKKNKLEPNDISLNGGSHDAWAYPIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGV 618
              ...|:|.|..:.|.:|            ||..::::.:...:|..|||:...|.|::...:|.
 Worm   478 --GGDLDPTDTRVWGSAH------------YDQTTNNLTIFAPIIDGPYFDTSYPNYVNQFLMGF 528

  Fly   619 SIAKEILRSI---------------------TKSFDEKAMRCVPHSVN---------------IF 647
            .:.:|:.||:                     .|.|||. ::|.....:               |.
 Worm   529 ILGRELGRSLDSVRIRKDEKGQTENWLKPESLKRFDEH-LKCWAEKYDKSADPLKSESKGIRQIE 592

  Fly   648 SNYSRMDILIHSGGMQISYHSMLSLTGPIKGMARLPGLNLTP-TQIFFLVSAQELC----AESNY 707
            ..|.:.::.....|.:.|:.:.:.|  .:|....|....:.. .::||.|.|...|    ..:::
 Worm   593 GRYIQNEMFADFIGHEASWRAFMKL--DVKNEEVLETFKVIKLRRMFFNVQALYFCRPPSGSTDW 655

  Fly   708 L--------------GIDTNAPEFDNILGWLVAQGGSATEVFKCPSGSMINVQKTCNV 751
            |              |...|.|:|              ...|:|.|...:|.|..|::
 Worm   656 LSYQEHHQHYSFRVNGAFKNMPQF--------------ALAFECASDDDMNPQNKCSM 699

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 117/681 (17%)
nep-9NP_494531.2 M13 87..698 CDD:189000 118/680 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.