DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and nep-13

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001342017.1 Gene:nep-13 WormBaseID:WBGene00018196 Length:732 Species:Caenorhabditis elegans

Alignment Length:825 Identity:146/826 (18%)
Similarity:291/826 (35%) Gaps:230/826 (28%)


  Fly    55 SKQMGKSDEIEMIDSANIENFNTRYNKNSIIGWICCAPCIWLRTSAAVHKMAITSATLLVTTLLV 119
            |:.:..:..:|:.:....|.     :.|..:...|..|.|           :|....:::...:.
 Worm     9 SRLLSSTQNLEVEEDGEEEG-----DDNEKVSKCCIYPLI-----------SIIICLVIIAICMG 57

  Fly   120 ASPILFLISTAPSPLPRDCYMDGDRCSPAVSAPPECSDPICEAVASSIQARLNW---NKDPCTEF 181
            |..:.:.:.:||..:   |..|.::....      |....|..::|::   |||   |.|||.:|
 Worm    58 AVIVFWRMDSAPQAI---CKTDHNKTRDV------CKTAECITLSSTL---LNWQNTNIDPCEDF 110

  Fly   182 KKFSCWR---NTPNKNITNLIEMGNSQKSVDSQML--YLFQNK-IMNGSFGILHNLFESCL---- 236
            .::||.|   :|.|..|     ..|.:.::..:::  ::.:|: ..:.|...|..|:|.|.    
 Worm   111 YEYSCGRYQEHTLNDGI-----RANEKDTIVMKLIRQFVLKNQSTTSNSENALMLLYEKCSLRYR 170

  Fly   237 -----QQTTNSTVMHRIFDSLG--GYLPVGSVG-----------PSSIAPLIAKIYDLGPSPLVD 283
                 |:|  ..:...:|:::.  |..|:....           .|::|.:....:.|..:.:::
 Worm   171 MENRHQET--EVIQREVFENIRKIGSWPIADKNWNSSHFNLNNMLSNMASIHMLPFGLFETRVIE 233

  Fly   284 LYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSRIRQGVP-----KLLADLIENFLP 343
            ||                  ..::|..:..||       |::::..:|     :.:.||:.  :.
 Worm   234 LY------------------PMNTTAKQLVIR-------PTKLKFSIPQEELVRAIRDLLS--VN 271

  Fly   344 YFVSYAQRVSEKDTI--FEFIKDLNKLQVEHSRRGFWDSTVLYNVSSLQDLYPVLNWTLLIPQ-- 404
            ...|..::|.| |..  |...|::..:.::...:.       ..:|.||...|.:::..:|..  
 Worm   272 GITSIMKKVKE-DVAESFALDKEIGNIHIDPQPKP-------ATLSELQKAVPDIDFERIIKSYL 328

  Fly   405 -----NWSG----------------------------PIVVRNSDYLKALE--YFLTKYPTRVAH 434
                 |||.                            |.::.|..:||.:|  ||.....|:|  
 Worm   329 NPKTGNWSSLRTKIFSARFELFFGKNNNLSSIIARTKPRILANYLFLKYIEYAYFFFFDNTKV-- 391

  Fly   435 NSLLLLSALQILPRDYPSPEVCTRSTMWALPELSSSLYIAQH-------SSEDLKDTTKRA--EI 490
                           :...:.||.....:||..|..:::..|       .:.::.:..|.|  ||
 Worm   392 ---------------FSDDDFCTEVVTTSLPRASLRVFVRNHFKKENMAVASEIVEVVKTAYVEI 441

  Fly   491 IFKSLKAHLKRAPSLKGAALVKLSALKIQSQTWEGFSNTTDLLKSLQPLNITSECWFQNILEIYK 555
            |..|...|    .|.:.:|:.|:..:|......|.:..|..|.:..:.|.::....|..::....
 Worm   442 INNSTWLH----NSTRESAIEKVVKMKKVIGYTEEYERTGALDEMFETLQLSRSDSFFVLMTKVN 502

  Fly   556 KNKLEPNDISLNGGSHDAWAYPI----VSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASV 616
            :.|:|.   .::..|.|:...||    ::..||....:.:.|.:..:..|.|:...|.|:..|.|
 Worm   503 RFKIEQ---LMDFVSSDSLLNPIEPLVMANAFYFPTKNLLNVLVPFLDKPLFDFKYPRYVAMAGV 564

  Fly   617 GVSIAKEI---------------------LRSITKSFDEKAMRCVPHSVNIFSNYSRMDILIHSG 660
            |..:|.||                     .|..|:.:|.:: .|....   |:|:..........
 Worm   565 GRVLAHEIGHAFDINGRQTDEIGRTRDWWTREDTEEYDRRS-ECFAEQ---FTNFKDPSFKGKQN 625

  Fly   661 GMQISYHSMLSLTGPIKGMARLPGLNLTPTQ------------IFFLVSAQELCAE-------SN 706
            |.::....:....|..........:|||..|            ::|.|:|.:.||.       |:
 Worm   626 GTEVLAEIIADALGMEASWIAFKKINLTEEQGLIQFEDHDFGKLYFQVAALDFCAPSRIEERYSD 690

  Fly   707 YLGIDTNAPEFDNILGWLVAQGGSATEVFKCPSGSMINVQKTCNV 751
            .|...||....:...    :...:..:.:|||.||.:|..:.|::
 Worm   691 QLSHPTNKFRINGAF----SNSRAFADTYKCPVGSKMNPVQRCDM 731

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 125/698 (18%)
nep-13NP_001342017.1 M13 104..729 CDD:189000 125/699 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.