DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Ecel1

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001264854.1 Gene:Ecel1 MGIID:1343461 Length:775 Species:Mus musculus

Alignment Length:730 Identity:154/731 (21%)
Similarity:265/731 (36%) Gaps:178/731 (24%)


  Fly   150 SAPPECSDPICEA-VASSIQARLNWNKDPCTEFKKFSC--W---RNTPNKNIT--NLIEMGNSQK 206
            :.|..|.:....| .|..:.|.|:.:.|||.:|..|:|  |   ...|:..:|  .:..:|..  
Mouse    95 ACPEGCPERKAFARAARFLSANLDASIDPCQDFYSFACGGWLRRHAIPDDKLTYGTIAAIGEQ-- 157

  Fly   207 SVDSQMLYLFQNKIMNGSFGI----LHNLFESCLQ----QTTNSTVMHRIFDSLGGYLPVGSVGP 263
              :.:.|.....:...|..|.    :...|.|||.    :......|..:.:..||:    .:|.
Mouse   158 --NEERLRRLLARPTGGPGGAAQRKVRAFFRSCLDMREIERLGPRPMLEVIEDCGGW----DLGG 216

  Fly   264 SSIAPLIAKIYDL-----------GPSPLVDLYHDLSYGRRPHILLIISGPSTSSTILERKIRWM 317
            ::..|..|: :||           ..:.|..|  .:|...|.....:|.......|:.||.: ::
Mouse   217 AADRPGAAR-WDLNRLLYKAQGVYSAAALFSL--TVSLDDRNSSRYVIRIDQDGLTLPERTL-YL 277

  Fly   318 SPKAPPSRI-------RQGVPKLL-ADLIENFLPYFVSYAQR-----VSEKDTIFEFIKDLNKLQ 369
            :......:|       .|.:.:|| ||.:|......:...||     |||.|       ||.:  
Mouse   278 AQDEESEKILAAYRVFMQRLLRLLGADAVEQKAQEILQLEQRLANISVSEYD-------DLRR-- 333

  Fly   370 VEHSRRGFWDSTVLYN---VSSLQDLYPVLNWTLLIPQ------NWSGPIVVRNSDYLKALEYFL 425
                     |.:..||   :..||.:.|.|.|..|:.|      :....:|:..:||::.:...:
Mouse   334 ---------DVSSAYNKVTLGQLQKIIPHLQWKWLLDQIFQEDFSEEEEVVLLATDYMQQVSQLI 389

  Fly   426 TKYPTRVAHNSL-----LLLS---------ALQILPR-----DYPS--PEVCTRSTMWALPELSS 469
            ...|.|:.||.|     ::||         ||..|.:     |.|.  ..||.............
Mouse   390 RSTPRRILHNYLVWRVVVVLSEHLSSPFREALHELAKEMEGNDKPQELARVCLGQANRHFGMALG 454

  Fly   470 SLYIAQHSSEDLKDTTKRAEIIFKSLKAHL-KRAPSL-------KGAALVKLSALKIQSQTWEGF 526
            :|::.:|.|...|   .:.:.:.:.:|..| :|...|       |.||..||..:.:.    .|:
Mouse   455 ALFVHEHFSAASK---AKVQQLVEDIKYILGQRLEELDWMDAQTKAAARAKLQYMMVM----VGY 512

  Fly   527 SNTTDLLKSLQPLNITSECWFQNILEIYKKNKLEPNDISLNGG--------SHDAWAYPIVS-TI 582
               .|.|  |:|..:..|..|:...:.|.||.|.....|:...        ...:|..|..: ..
Mouse   513 ---PDFL--LKPEAVDKEYEFEVHEKTYFKNILNSIRFSIQLSVKKIRQEVDKSSWLLPPQALNA 572

  Fly   583 FYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSITKSFDE------------- 634
            :|....:.:|.|..::....::...|..|:|..:|..|..|    :|..:|:             
Mouse   573 YYLPNKNQMVFPAGILQPTLYDPDFPQSLNYGGIGTIIGHE----LTHGYDDWGGQYDRSGNLLH 633

  Fly   635 -----------KAMRCVPHSVNIFSNYSRM--------DILIHSGGMQISYHSMLSLT---GPIK 677
                       :...|:....:.|:.|::.        :.:...||::::|::.....   ||..
Mouse   634 WWTETSYSHFLRKAECIVRLYDNFTVYNQRVNGKHTLGENIADMGGLKLAYYAYQKWVREHGPEH 698

  Fly   678 GMARLPGLNLTPTQIFFLVSAQELC----AESNYLGI--DTNAPEFDNILGWLVAQGGSATEVFK 736
            .:.|   |..|..|:||:..||..|    ::|.||.:  |.:|||...:|| .|:|.......|.
Mouse   699 PLHR---LKYTHNQLFFIAFAQNWCIKRRSQSIYLQVLTDKHAPEHYRVLG-SVSQFEEFGRAFH 759

  Fly   737 CPSGSMINVQKTCNV 751
            ||..|.:|....|:|
Mouse   760 CPKDSPMNPVHKCSV 774

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 146/700 (21%)
Ecel1NP_001264854.1 PepO 112..766 CDD:226118 147/704 (21%)
M13 121..773 CDD:189000 147/702 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.