DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Ece2

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:XP_006521754.2 Gene:Ece2 MGIID:1101356 Length:787 Species:Mus musculus

Alignment Length:718 Identity:149/719 (21%)
Similarity:252/719 (35%) Gaps:186/719 (26%)


  Fly   108 TSATLLVTTLLVASPILFLISTAPSPLPRDCYMDGDRCSPAVSAPPECSDPICEAVASSIQARLN 172
            |...|::..|::....|.|.......:.||         ||.|.   |....|..||..|...|:
Mouse    57 TQLELVLAGLILVLAALLLGCLVALWVHRD---------PAHST---CVTEACIRVAGKILESLD 109

  Fly   173 WNKDPCTEFKKFSC--W-RNTPNKNITNLIEMGNSQKSVDSQML-YLFQNKIMNGSFGI---LHN 230
            ....||.:|.:|||  | |..|..|..:.....||....:..:| :|.:|...|.|...   ..:
Mouse   110 RGVSPCQDFYQFSCGGWIRRNPLPNGRSRWNTFNSLWDQNQAILKHLLENTTFNSSSEAERKTRS 174

  Fly   231 LFESCLQ----QTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLIAKIYDLGPSPLVDLYHDLSYG 291
            .:.||||    :...:..:..:.|.:||:...|.....|...::..:..             :|.
Mouse   175 FYLSCLQSERIEKLGAKPLRDLIDKIGGWNITGPWDEDSFMDVLKAVAG-------------TYR 226

  Fly   292 RRPHILLIISGPSTS--STILERKIRWMSPKAPPSR----IRQGVPKLLADLIENFLPYFVSYAQ 350
            ..|...:.:|..|.|  |.|::..   .|....|||    .|....|:|.    .:|.|.|....
Mouse   227 ATPFFTVYVSADSKSSNSNIIQVD---QSGLFLPSRDYYLNRTANEKVLT----AYLDYMVELGV 284

  Fly   351 RVSEKDT--------IFEFIKDLNKLQVEHSRRGFWDSTVLY---NVSSLQDLYPVLNWT----- 399
            .:..:.|        :.|....|..:.|...:|.  |...:|   ::|.||.|.|.::|.     
Mouse   285 LLGGQPTSTREQMQQVLELEIQLANITVPQDQRR--DEEKIYHKMSISELQALAPAVDWLEFLSF 347

  Fly   400 LLIPQNW--SGPIVVRNSDYLKALEYFLTKYPTRVAHNSLL------LLSAL---------QILP 447
            ||.|...  |.|:||..::||:.:...:.:....:.:|.|:      ..|:|         ::|.
Mouse   348 LLSPLELGDSEPVVVYGTEYLQQVSELINRTEPSILNNYLIWNLVQKTTSSLDQRFETAQEKLLE 412

  Fly   448 RDY-------PSPEVCTRSTMWALPELSSSLYI-------AQHSSEDLKDTTKRA------EIIF 492
            ..|       |..:.|..:|..||.....||::       ::..:|.:.:..:.|      ::::
Mouse   413 TLYGTKKSCTPRWQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMINEIRSAFEETLGDLVW 477

  Fly   493 KSLKAHLKRAPSLKGAALVKLSAL-------------KIQSQTWEGFSNTTDLLKSLQPLNITSE 544
            ...|..|        ||..|..|:             |.....::|:             .::.:
Mouse   478 MDEKTRL--------AAKEKADAIYDMIGFPDFILEPKELDDVYDGY-------------EVSED 521

  Fly   545 CWFQNILEIYKKNKLEPNDISLNGGSHDAWAY-PIVSTIFYDTLSHSIVVPLSVILIPYFNAVLP 608
            .:|||:|.:|..:.....|......|.|.|:. |.....:|....:.||.|..::..|::....|
Mouse   522 SFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYAHNHP 586

  Fly   609 PYLHYASVGVSIAKEILRSITKSFD------EKAMRCVP----HSVNIFSNYSRMDILIHSGGMQ 663
            ..|::..:||.:..|    :|.:||      :|.....|    .|:..|.|        |:..|:
Mouse   587 KALNFGGIGVVMGHE----LTHAFDDQGREYDKEGNLRPWWQNESLTAFQN--------HTACME 639

  Fly   664 ISYHSMLSLTGPIKGMARLPGLNLTPTQIFFLVSAQELCAESNYLGIDTNAPEFDNILGWL---V 725
            ..| |...:.|     .||.||......|     |.....::.|           |:.||:   |
Mouse   640 EQY-SQYQVNG-----ERLNGLQTLGENI-----ADNGGLKAAY-----------NVSGWVPQTV 682

  Fly   726 AQG 728
            ::|
Mouse   683 SKG 685

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 133/651 (20%)
Ece2XP_006521754.2 M13 112..673 CDD:189000 128/638 (20%)
PKc_like <670..>706 CDD:304357 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.