DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and kel

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:XP_005157998.1 Gene:kel ZFINID:ZDB-GENE-110411-118 Length:759 Species:Danio rerio

Alignment Length:716 Identity:145/717 (20%)
Similarity:239/717 (33%) Gaps:233/717 (32%)


  Fly   150 SAPPECSDPICEAVASSIQARLNWNKDPCTEFKKFSCWRNTPNKN-----------------ITN 197
            ||.|.|..|.|...:......::....||..| .|:|.....:.|                 ...
Zfish    73 SAAPLCLSPACIRASEHFSVAMDPFSRPCDYF-LFACGAGGSSTNRDRQRVKGEVNKHSEVRTRG 136

  Fly   198 LIEM--GNSQKSVDSQMLYLF---QNKIMNGSFGILH----------------NLFESCL----Q 237
            ||||  |....|.....|..|   |..::.....||.                |.|:||:    :
Zfish   137 LIEMRRGTDGWSKSDGQLKTFPDRQTALLTAIKEILEAPDEAVSMGAAEQKAKNFFKSCMNAESR 201

  Fly   238 QTTNSTVMHRIFDSLGGYLPVG-------------SVGPSSIAPLIAKIYDLGPSPLVDLYHDLS 289
            :...|.....:...|||:...|             .:|..|..|.. .:| :||.|    ..:.|
Zfish   202 EKMGSEPFLTLLQQLGGWAVSGVWNQTDFNSTLALLMGQYSTFPFF-NVY-VGPEP----SEEQS 260

  Fly   290 YGRRPHILLIISGPSTSSTILERKIRWMS----PKAPPSRIRQ------------GVPK------ 332
            ...|.:|.  |..|.     .:..|.|.|    .||....:|.            |||.      
Zfish   261 ASNRHYIQ--IDEPH-----FQFPIEWNSKTQKAKANTRYLRPFYSACGQYLVLLGVPSDRTTQH 318

  Fly   333 --LLADL-----IENF-LPYFVSYAQRVSEKDTIFEFIKDLNKLQVEHSRRGFWDSTVLY---NV 386
              |...|     :..| |||      |:|:|                          :||   .:
Zfish   319 CGLFVSLSTTLAVATFPLPY------RLSQK--------------------------LLYRRTTI 351

  Fly   387 SSLQDLYPVLNWTLLIPQNWSGPIVVRNSDYLKA--LEYFL----TKYPTRVAH--------NSL 437
            ..||.|.|.::|...:...:. |:::..||.:..  |.|.:    |.:..:|.|        |:.
Zfish   352 QELQTLAPAVDWLACLQATFQ-PLLISKSDIVLVHNLPYIIHMSKTIHLWQVQHELMGTGPLNTY 415

  Fly   438 LLLSALQ-ILP----------RDY----------PSPEVCTRSTMWALPELSSSLYIAQHSSEDL 481
            ::.|.|| ::|          |:|          |....|.:.|......|.|.....:|:.   
Zfish   416 MIFSLLQTLIPALDSRFFQIMRNYSIATGDTQEMPHWWRCVQQTERGFDTLLSHAIREKHAQ--- 477

  Fly   482 KDTTKRAEIIFKSLKAHLK----RAPSLKGAALVKLSALKIQSQTWEGFSNTTDLLKSLQPLNIT 542
            |:..:..:.::.|||..|.    |........|.|:::|..:..|.....:.|:|....:.:.:.
Zfish   478 KEAEELIQDVYSSLKKKLTDLSWRDEKESDFILNKINSLNPRISTNTNNLSYTELNHLYEKVILN 542

  Fly   543 SECWFQNILEI-YKKNKLEPNDISLNGGSHDAWAYPIVSTIFYDTLSHSIVVPLSVILIPYFNAV 606
            .|.:|.|.|:| ..:.|.....:||...:......|.:|       .:.|:||:.:.:.|:|::.
Zfish   543 EEDFFSNYLQILLLEQKSRARLLSLGTQTEGLSMTPFIS-------GNDIIVPVGMFVSPFFHSS 600

  Fly   607 LPPYLHYASVGVSIAKEILRSITKSFDEKAMRCVPHSVNIFSNYSRMDILIHSGGMQISYHSMLS 671
            .|..|:|.::|..:||::|..:......||......|:.::|:|                   ||
Zfish   601 YPRALNYGTLGSLMAKDLLHLLLPDIYTKAKNPETESLCVWSHY-------------------LS 646

  Fly   672 LT-GPIKGMARLPGLNLTPTQIFFLVSA--QELCAESNYLGI--------------DTNAPEFDN 719
            :| ||..|.|            |:|.|:  ||:..:.:.|.:              |::.|.|..
Zfish   647 VTKGPGWGDA------------FYLPSSKQQEVWVQYSALQVALDAYKMSFKRYLADSSLPGFSY 699

  Fly   720 I 720
            :
Zfish   700 V 700

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 139/691 (20%)
kelXP_005157998.1 GluZincin 99..>620 CDD:301352 118/578 (20%)
GluZincin 583..>721 CDD:301352 33/150 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.