DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and mme

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:XP_017949522.1 Gene:mme XenbaseID:XB-GENE-1011098 Length:721 Species:Xenopus tropicalis

Alignment Length:749 Identity:155/750 (21%)
Similarity:263/750 (35%) Gaps:216/750 (29%)


  Fly   162 AVASSIQARLNWN----KDPCTEFKKFSC--W---RNTPNKNITNLIEMGNSQKSVDSQMLYLFQ 217
            |.|:|..||:..|    .|||.:|.:::|  |   ...|:.||     :.|:...:.:.:..:.:
 Frog    29 AYATSNAARIIANMDAATDPCNDFYQYACGGWLKKNRIPDNNI-----VSNTFDILRTDIEVVLK 88

  Fly   218 NKIMNGS------FGILHNLFESCLQQTTNS--------TVMHRIFDSLGGYLPV---------G 259
            :.:...|      ...:...::||:.:|..:        ..:..::|     .|:         |
 Frog    89 DALEKESADDIPAIKKVKTFYKSCIDETIKNLRKGGPLIKTLPALYD-----WPIAVDNWETRYG 148

  Fly   260 SV--GPSSIAPLIAKIYDLGPSPLVDLYHDLSYGRRPHILLIISGPSTSSTILERK----IRWMS 318
            .|  ...|||..|.|   .|.|.|:::|...........:|.|..|...   |..|    .:..|
 Frog   149 LVWSAQESIAGFITK---YGQSGLINVYVSEDLTNSSTYILHIDQPGLG---LPSKDYYDCKGTS 207

  Fly   319 PKAPPSRIRQGVPKLLADLIENFLPYFVSYAQRVSEKDTIFEFIKDLNKLQV-EHSRRGFWDSTV 382
            ..|..:.:.|.|.  :|.||.......::..:.:||.:.:|:..:::.|.:. |..|....|...
 Frog   208 EIACLAYMEQMVS--VAMLIRKERNLTINEDKILSEMEKVFKLEREIAKAEASEEIRENLNDIYK 270

  Fly   383 LYNVSSLQDLYPV------LNWTLLIPQNWS--GPIVVRN-------SDYLKALEYFLTKYPTRV 432
            ...:|.:...||:      :||..||....|  |..:..|       |||||.|. ||.||..|.
 Frog   271 KMTLSGIAKTYPLKMNDQNINWLKLINAIISPGGVSIEENEQVALICSDYLKKLR-FLNKYKARE 334

  Fly   433 AHNSL---LLLSALQILPRDYPSPEVCTRSTMWA------------------LPELSSSLYIAQH 476
            ..|.|   .:|||:..|..:|.:..:..:..::.                  :.:....||:.:.
 Frog   335 LQNYLGWRYILSAINDLSLEYKNTGIHLKKALYGNAAEGSDWQTCVTYLNDNMEDAIGRLYLKEM 399

  Fly   477 SSEDL----KDTTKRAEIIFKSLKAHLKRAPSL-------KGAALVKLSALKIQSQTWEGFSNTT 530
            .|.|:    ||..|  |||.:..:|.|:....:       |..|..|::::..:....|...:..
 Frog   400 LSADIEHVVKDKVK--EIIAEIRRAFLEMLEEMDWMDEDTKKRAARKVASINERIAFSEDIMDDF 462

  Fly   531 DLLKSLQPLNITSECWFQN---------------ILEIYKKNKLEPNDISLNGGSHDAWAYPIVS 580
            .|.:....|....:..|:|               :.:...||:..|....:|.            
 Frog   463 KLNEGYSELEFRVDELFENKQKYIEFVQKKMTSRLRKQVNKNEWVPGPAHVNA------------ 515

  Fly   581 TIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSITKSFDEKAMRCVPHS-- 643
              ||....:.||.|..::..|:|::..|..|:|..:|:.|..|    ||..||.:......|.  
 Frog   516 --FYSLTYNEIVFPAGILQTPFFSSSQPSALNYGGIGMIIGHE----ITHGFDNRGCNFDEHGNL 574

  Fly   644 -------------------VNIFSNYSRMDILIHSGGMQISYHSML----SLTGPIKGMAR---- 681
                               ||.:.|||..:    :||..::..|.|    |..|.|:|..|    
 Frog   575 VNWWTNASMMNFSNLSQCFVNQYGNYSWDE----AGGQYLNGISTLGENISDNGGIRGAYRAFKN 635

  Fly   682 ----------LPGLNLTPTQIFFLVSAQELCA--ESNY-----------------LGIDTNAPEF 717
                      |||::|...|:||:...|..|.  ...|                 :|...|:|||
 Frog   636 YVKSHKEDDLLPGIDLDSDQLFFISFGQIWCGMHRPEYAATLIKTGSHTPGIFRVIGTLQNSPEF 700

  Fly   718 DNILGWLVAQGGSATEVFKCPSGSMINVQKTCNV 751
                          ::.|.|.:.:.:|....|.:
 Frog   701 --------------SKAFSCCNNAYMNPAVKCKL 720

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 148/728 (20%)
mmeXP_017949522.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.