DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and ecel1

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:XP_012818808.1 Gene:ecel1 XenbaseID:XB-GENE-989944 Length:764 Species:Xenopus tropicalis

Alignment Length:719 Identity:147/720 (20%)
Similarity:260/720 (36%) Gaps:214/720 (30%)


  Fly   177 PCTEFKKFSC--W---RNTPNKNIT--NLIEMG-NSQKSVDSQMLYLFQNKIMNGSFGILHNLFE 233
            |||:|..|:|  |   ...|...:.  .:..:| .:::.::..:|...:.|....:...:...|:
 Frog   115 PCTDFYSFACGGWLRRHGIPEDKLIYGTIAAIGEQNEEKLEHLLLQPVRRKHKGSAERKVKEFFK 179

  Fly   234 SCLQQTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLIAKIYDLG-------PSPLVDLYHDLSYG 291
            |||..        |..|.||.            .|::..|.|.|       |....| :::|.|.
 Frog   180 SCLNM--------RDIDRLGA------------RPMLQVIEDCGGWDLPEDPRTQWD-FNELLYK 223

  Fly   292 RR----------------------------------PHILLIISGPSTSSTILERKIRWMSPKAP 322
            .:                                  |...|.:.....|..:||....:|     
 Frog   224 TQGVYSTAVFFSMTVSLDDKNSSRYIIRIDQDGLTLPERTLYLGQDEESIKVLEAYKVFM----- 283

  Fly   323 PSRIRQGVPKLLADLIENFLPYFVSYAQRVSEKDTIFEFIKDLNKLQV---EHSRRGFWDSTVLY 384
                 |.:..||.  :||        .|:.:|:  |....:.|:.:.:   :..||   |.:.:|
 Frog   284 -----QTILSLLG--VEN--------VQKKAEE--ILHLEQHLSNITISEFDDMRR---DISTMY 328

  Fly   385 N---VSSLQDLYPVLNWTLLI--------PQNWSGPIVVRNSDYLKALEYFLTKYPTRVAHNSLL 438
            |   ::.||.:.|.|||..|:        |::  ..:||..:||::.:...:...|..|.||.:|
 Frog   329 NKVTLAQLQQITPHLNWKNLLNRIFHTNFPED--EEVVVLATDYMQKVSEMIRSTPASVLHNYML 391

  Fly   439 -----LLS---------ALQILPRDYPSPEVCTRSTMWALPELS-------SSLYIAQHSSEDLK 482
                 :||         |:..|.::....|.....|...|.:.:       .:|::.::.|...|
 Frog   392 WRIVVVLSEHLSTPFRDAIHELSKEMEGSEKQAELTKVCLTQANKHFGMALGALFVEEYFSSSSK 456

  Fly   483 DTTKRAEIIFKSLKAHLKRAPSL-------KGAALVKLSALKIQSQTWEGFSNTTDLLKSLQPLN 540
            ...::.....|.:..|  |...|       |.||..||..:.:..    |:   .|:|  |||.:
 Frog   457 AKVQQLVENIKHILDH--RLEELDWMDTETKQAAREKLKHMMVMI----GY---PDVL--LQPES 510

  Fly   541 ITSECWFQNILEIYKKNKLEPNDISLNGG--------SHDAWAYPIVS-TIFYDTLSHSIVVPLS 596
            :..|..|:...:.|.||.|.....|:...        ...||..|..: ..:|....:.:|.|..
 Frog   511 MDKEYEFEVNEKTYFKNILNSIRYSIKMAVRRIRQEVDKSAWLLPPQALNAYYLPNKNQMVFPAG 575

  Fly   597 VILIPYFNAVLPPYLHYASVGVSIAKEILRSITKSFDE------------------------KAM 637
            ::....::...|..|:|..:|..|..|    :|..:|:                        |..
 Frog   576 ILQPTLYDPDFPQSLNYGGIGTIIGHE----LTHGYDDWGGQYDANGNPIQWWTEDSYSKFLKKA 636

  Fly   638 RCVPHSVNIFSNYSRMDILIHS-----------GGMQISYHS---MLSLTGPIKGMARLPGLNLT 688
            .|:   |:::.|::..:..::.           ||::::|::   .:...||.:   .||.|..|
 Frog   637 ECI---VDLYENFTVYNQRVNGRTTLGENIADLGGLKLAYYAYQKWVRDNGPER---PLPRLKYT 695

  Fly   689 PTQIFFLVSAQELC----AESNYLGI--DTNAPEFDNILGWLVAQGGSATEVFKCPSGSMINVQK 747
            ..|:||:..||..|    ::|.||.:  |.:|||...::| .|:|......||.||..|.:|...
 Frog   696 HDQLFFIAFAQNWCIKRRSQSIYLQVLTDKHAPEHYRVMG-SVSQFEEFGRVFHCPRNSPMNPVH 759

  Fly   748 TCNV 751
            .|:|
 Frog   760 KCSV 763

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 145/716 (20%)
ecel1XP_012818808.1 PepO 102..755 CDD:226118 144/710 (20%)
M13 113..762 CDD:189000 146/717 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.