DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and ece1

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:XP_002943486.3 Gene:ece1 XenbaseID:XB-GENE-1014218 Length:365 Species:Xenopus tropicalis

Alignment Length:264 Identity:56/265 (21%)
Similarity:92/265 (35%) Gaps:99/265 (37%)


  Fly   358 IFEFIKDLNKLQVEHSRRGFWDSTVLYN---VSSLQDLYPVLNW-----TLLIPQ--NWSGPIVV 412
            |.:|...|..:.:...:|.  |...:|:   ...|:||.|.::|     |:..|.  |.|.|:||
 Frog   115 ILDFETTLANITIPQEKRR--DEEQIYHKMAAGELKDLVPAVDWMPFLQTVFYPVAINESEPVVV 177

  Fly   413 RNSDYLKALEYFLTKYPTRVAHNSLLLLSALQILPRDYPSPEVCTRSTMWALPELSSSLYIAQHS 477
            ...:||.|:...:.....|:.:|.:                       ||.|...:|| ::.|. 
 Frog   178 YAKEYLVAVSGLINSTDKRILNNYM-----------------------MWNLVRKASS-FLDQR- 217

  Fly   478 SEDLKDTTKRAEIIFKSLKAHLKRAPSLK--------------GAALV--------KLSALK--- 517
            .:|.::  |..|:::.:.|..|   |..|              ||..|        ||.|||   
 Frog   218 FQDAEE--KLMEVMYGTKKTCL---PRWKFCISDTDNNLGFALGAMFVKATFAENSKLQALKMIK 277

  Fly   518 ---------IQSQTWE-------------------GFSN----TTDLLKSLQPLNITSECWFQNI 550
                     :.:.||.                   |:.|    ..:|.|.....|:||:.:|:|.
 Frog   278 EIKAAFEENLSTLTWMDDETRRAAREKAEAIYDMIGYPNFIMDPKELDKVFNDYNVTSDFYFENG 342

  Fly   551 LEIY 554
            :..|
 Frog   343 MRFY 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 56/265 (21%)
ece1XP_002943486.3 M13 45..>364 CDD:189000 56/265 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.