DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and LOC100332538

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:XP_021322193.1 Gene:LOC100332538 ID: Length:808 Species:Danio rerio

Alignment Length:729 Identity:156/730 (21%)
Similarity:272/730 (37%) Gaps:197/730 (27%)


  Fly   164 ASSIQARLNWNKDPCTEFKKFSC--W---RNTPNKNITNLIEMGNSQKSVDSQMLYL---FQNKI 220
            |..:|..::.:..||.:|..|:|  |   ...|...::..|.....:::.|.....|   .|.:.
Zfish   135 ARFVQGNIDPSVQPCHDFYSFACGGWLRRHGIPEDKLSYGIITAIGEQNQDKLQRLLQAPVQRRE 199

  Fly   221 MNGSFGILHNLFESCLQ----QTTNSTVMHRIFDSLGGY----LPVGSVGPSSIAPLIAKIYDLG 277
            :..:...:...:.||:.    ....:..|..:.||.||:    .|.|..|           :|.|
Zfish   200 LESAERKVKEFYRSCINIKEIDRLGAGPMTEVIDSCGGWDLSGAPPGGAG-----------WDSG 253

  Fly   278 PSPLVDLYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSRIR---QGVP-------- 331
            .:|:...::::.|..:        |..::|......:......:..:.||   :|:.        
Zfish   254 SAPIRPDFNEMLYKTQ--------GVYSTSVFFSLTVSVDDKNSSRNAIRIDQEGLTLPERTLYL 310

  Fly   332 -------KLLAD---LIENFLPYFVSYAQRVSEKDTIFEFIKDL-NKL------QVEHSRRGFWD 379
                   |:||.   |:|..|....::...:..::     |.|| .||      :.|..|:   |
Zfish   311 GQDEDSVKILASYKALMERLLSMLGAHNATLKSRE-----ILDLETKLANITVSEYEDQRK---D 367

  Fly   380 STVLYN---VSSLQDLYPVLNWTLLIPQ----NWS--GPIVVRNSDYLKALEYFLTKYPTRVAHN 435
            .:.:||   :..||.:.|..:|..|:.:    |:|  ..|||..:||::.:...:.....||.||
Zfish   368 ISSMYNRITLKQLQKMAPSFHWKRLLDRIFNDNFSEEEEIVVLATDYMQTVSDIIKTTSKRVLHN 432

  Fly   436 SLL--LLSALQILPRDYPSPEVCT--RSTMWALPELS---------------------------- 468
            .:|  :::||        |..:.|  |||   :.|.|                            
Zfish   433 YMLWRMVAAL--------SEHLSTAFRST---IHEFSREIDGTEQQLDLERLCLTQANKHFGMAL 486

  Fly   469 SSLYIAQH-SSEDLKDTTKRAEIIFKSLKAHLKRA----PSLKGAALVKLSALKIQSQTWEGFSN 528
            .:|::.|| ||.......:..|.|..||...|:..    ...|.||..||..:.:.: .:..|..
Zfish   487 GALFVQQHFSSSSRAKVQELVEDIKHSLDVRLQELDWMDEETKDAARGKLQHMMVMT-GYPDFLL 550

  Fly   529 TTDLLKSLQPLNITSECWFQNILEIYKKN-KLEPNDISLNGGSH-----DAWAYPIVS-TIFYDT 586
            ..:|:......::..:.:|:|||...|.| ||....|      |     ..|..|..: ..:|..
Zfish   551 KPELIDEEYAFDVNEKTYFKNILNSIKYNIKLSIKKI------HKEVDKTTWLLPPQALNAYYLP 609

  Fly   587 LSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSITKSFD------------------ 633
            ..:.:|.|..::....::...|..|:|..:|..|..|    :|..:|                  
Zfish   610 NKNQMVFPAGILQPTLYDPEFPQSLNYGGIGAIIGHE----LTHGYDDWGGQYDRYGNLKQWWTE 670

  Fly   634 ------EKAMRCVPHSVNIFSNYS--------RMDI---LIHSGGMQISYHSMLSLT---GPIKG 678
                  :|...|:   |.::.|::        |:.:   :...||:::|||:.....   ||.: 
Zfish   671 ESYRKFQKKTECI---VKLYDNFTVYNQRVNGRLTLGENIADLGGLKLSYHAYQKWVREHGPER- 731

  Fly   679 MARLPGLNLTPTQIFFLVSAQELC----AESNYLGI--DTNAPEFDNILGWLVAQGGSATEVFKC 737
              .||||..|..|:||:..||..|    ::|.||.:  |.:|||...::| .|:|......||.|
Zfish   732 --PLPGLKHTHEQLFFIAFAQNWCMKRRSQSIYLQLLTDKHAPEHYRVIG-SVSQFEEFGRVFHC 793

  Fly   738 PSGSMINVQKTCNV 751
            |.||.:|....|:|
Zfish   794 PRGSPMNPVNKCSV 807

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 152/714 (21%)
LOC100332538XP_021322193.1 M13 146..806 CDD:189000 153/716 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.