DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and mmel1

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:XP_012821551.1 Gene:mmel1 XenbaseID:XB-GENE-991673 Length:765 Species:Xenopus tropicalis

Alignment Length:841 Identity:174/842 (21%)
Similarity:304/842 (36%) Gaps:244/842 (29%)


  Fly    58 MGKSD-EIEMIDSANIENFNTRYNKNSIIGWICCAPCIWLRTSAAVHKMAITSATLLVTTLLVAS 121
            ||||: ::::::.      :|:..|.|           |     :..::.::....|:|..:|| 
 Frog    21 MGKSESQMDIVEK------STKSAKKS-----------W-----SFVEIGLSVLLFLMTCAVVA- 62

  Fly   122 PILFLISTAPSPLPRDCYMDGDRCSPAVSAPPECSDPICEAVASSIQARLNWNKDPCTEFKKFSC 186
             :|.|.::....:                    |:...|...|:.|...::...:|||:|.:::|
 Frog    63 -LLVLYTSHKESI--------------------CTTTGCVTAAARIIQNMDPTIEPCTDFYQYAC 106

  Fly   187 --WRNTPNKNITNLIEMGNSQKSV-----DSQMLYL-----FQNKIMNGSFGILHNLFESCLQQT 239
              |.|      .::|...:|:.|:     |...:.|     ..::....:|.....|::||:.::
 Frog   107 GGWLN------KHVIPETSSRYSIFDILRDEMEIILKGLLEMPDQEDRDAFKKAKILYKSCMNES 165

  Fly   240 ----TNSTVMHRIFDSLGGYLPVGSVG----PSSIAPLIAKI----YDLGPSPLVDLY---HDLS 289
                .:|..:..:..::|.: ||.|..    ..|...|..|:    |......|||::   .|..
 Frog   166 LIEQRDSLPLLELLTTVGEW-PVASTDWNGTKESNWSLEEKLSLLNYKFNKRVLVDIFVWNDDRE 229

  Fly   290 YGRRPHILLI----ISGPSTSSTILERKIRWMSPKAPPSRIRQGVPKLLADLIENFLPYFVSYAQ 350
            ..:  ||:.|    :..||..         :...|....|||           |.:|.:.::.|:
 Frog   230 SSK--HIIYIDQPSLGMPSRD---------YYFNKGNYQRIR-----------EAYLQFMITIAR 272

  Fly   351 RV--------------SEKDTIFEFIKDLNKLQVEHSRRGFWDSTVLYNVSSL---QDLYPV--L 396
            .|              .|...:.:...|:.:.......|.  |.|:|||..:|   |..:.:  .
 Frog   273 MVREDRNLTRDDSLVQEEMTRVMDLETDIARATAPSEERN--DVTLLYNKMTLLEFQQKFALDDF 335

  Fly   397 NWTLLIPQNWSG---------PIVVRNSDYLKALEYFLTKYPTRVAHNSL---LLLSALQILPRD 449
            |||..|....|.         .:||..:.||..|:..|:.|......|.:   :::..:..|.|.
 Frog   336 NWTSFIQGVMSSVNIQLQAEEEVVVYGAPYLHQLKNILSNYSASTLQNYVVWRMVIDRVSSLSRR 400

  Fly   450 YPSPEVCTRSTMWA------------------LPELSSSLYIAQHSSEDLKDTTKR--AEIIFKS 494
            |.......|..::.                  :.....::|:    .|.....:||  :::|.|.
 Frog   401 YKDARASYRKALYGTTLEEARWRECVSYVNSNMENAVGAMYV----KETFAGESKRMISDLINKV 461

  Fly   495 LKAHLKRAPSL-------KGAALVKLSALKIQSQTWEGF-----SNTTDLL-KSLQPLNITSECW 546
            .:|.::....|       |..|..|  ||.|:.|.  |:     .:..|.| :....||.:...:
 Frog   462 REAFIETLDELQWMDETSKDKAREK--ALSIKEQI--GYPDYILEDQNDKLDQETAALNFSEYQY 522

  Fly   547 FQNILEIYK-------KNKLEPNDISLNGGSHDAWAY-PIVSTIFYDTLSHSIVVPLSVILIPYF 603
            |:|||||..       |...||.|       .|||.. ..|:..||....:.||.|..::..|:|
 Frog   523 FENILEILNSGAQKSLKKLREPVD-------QDAWIIGAAVADAFYSPNRNQIVFPAGILQPPFF 580

  Fly   604 NAVLPPYLHYASVGVSIAKEILRSITKSFDEKAMRCVPHSVNIF---SNYSRM------------ 653
            |...|..|::..:|:.|..|    ||..||:.. |......|:|   ||:|.|            
 Frog   581 NKHQPQALNFGGIGMVIGHE----ITHGFDDNG-RNFDKDGNMFDWWSNFSAMHFKDQSRCMVYQ 640

  Fly   654 ---------------------DILIHSGGMQISYHSMLSLTGPIKGMARLPGLNLTPTQIFFLVS 697
                                 :.:..:||::.:|.:.|..........:||||:||..|:|||..
 Frog   641 YGNYTWELAGGQNVSGIITLGENIADNGGVRQAYKAYLKWVERHGKEPKLPGLDLTYKQLFFLNF 705

  Fly   698 AQELCAE------SNYLGIDTNAPEFDNILGWLVAQGGSA-TEVFKCPSGSMINVQKTCNV 751
            ||..|..      .:.:..|.::|....::|.|  |...| .|.|.|..|:.::..:.|.|
 Frog   706 AQVWCGSYRPEYARHSIKTDVHSPFKYRVMGSL--QNFEAFAEEFNCKKGTKMHPVEKCRV 764

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 154/719 (21%)
mmel1XP_012821551.1 PepO 90..765 CDD:226118 156/729 (21%)
M13 95..763 CDD:189000 155/721 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.