DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31109 and KMT2D

DIOPT Version :9

Sequence 1:NP_001262946.1 Gene:CG31109 / 43001 FlyBaseID:FBgn0051109 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_011537072.1 Gene:KMT2D / 8085 HGNCID:7133 Length:5556 Species:Homo sapiens


Alignment Length:163 Identity:30/163 - (18%)
Similarity:60/163 - (36%) Gaps:35/163 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HIYSDHGQRLCLVEKINGYLPITISPTDPLPK--TICKSCLHRVEQ--------HYSLLMRLTRM 80
            |:.:..||     |:..|      .|:.|.|.  |..:..::..:|        |...|:::...
Human  3476 HVAAGSGQ-----ERSAG------DPSQPRPNPPTFAQGVINEADQRQYEEWLFHTQQLLQMQLK 3529

  Fly    81 ---------REERKFKLIKYKAQRNPSISSVESEEDVINSSSVHEFPNRNEEDQATR-RSESTST 135
                     |:.||....|.:..:.......|::.:.:...:..:...:.:.||..: :.|.|:.
Human  3530 VLEEQIGVHRKSRKALCAKQRTAKKAGREFPEADAEKLKLVTEQQSKIQKQLDQVRKQQKEHTNL 3594

  Fly   136 QAE----TGPQTQESQSPKSTKTAVSTPNSSES 164
            .||    ...|.|:.|..:...:||...:.|:|
Human  3595 MAEYRNKQQQQQQQQQQQQQQHSAVLALSPSQS 3627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31109NP_001262946.1 zf-AD 13..76 CDD:214871 12/59 (20%)
KMT2DXP_011537072.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.