DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31109 and KMT2D

DIOPT Version :8

Sequence 1:NP_001262946.1 Gene:CG31109 / 43001 FlyBaseID:FBgn0051109 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_011537072.1 Gene:KMT2D / 8085 HGNCID:7133 Length:5556 Species:Homo sapiens

Alignment Length:163 Identity:30/164 (18%)
Similarity:60/164 (37%) Gaps:35/164 (21%)


  Fly    26 HIYSDHGQRLCLVEKINGYLPITISPTDPLPK--TICKSCLHRVEQ--------HYSLLMRLTRM 80
            |:.:..||     |:..|      .|:.|.|.  |..:..::..:|        |...|:::...
Human  3476 HVAAGSGQ-----ERSAG------DPSQPRPNPPTFAQGVINEADQRQYEEWLFHTQQLLQMQLK 3529

  Fly    81 ---------REERKFKLIKYKAQRNPSISSVESEEDVINSSSVHEFPNRNEEDQATR-RSESTST 135
                     |:.||....|.:..:.......|::.:.:...:..:...:.:.||..: :.|.|:.
Human  3530 VLEEQIGVHRKSRKALCAKQRTAKKAGREFPEADAEKLKLVTEQQSKIQKQLDQVRKQQKEHTNL 3594

  Fly   136 QAE----TGPQTQESQSPKSTKTAVSTPNSSES 164
            .||    ...|.|:.|..:...:||...:.|:|
Human  3595 MAEYRNKQQQQQQQQQQQQQQHSAVLALSPSQS 3627

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31109NP_001262946.1 zf-AD 13..76 CDD:214871 12/60 (20%)
KMT2DXP_011537072.1 ePHD1_KMT2D 134..217 CDD:277165
PHD1_KMT2C_like 228..273 CDD:276984
PHD_SF 275..320 CDD:304600
PHD3_KMT2D 1378..1428 CDD:277072
PHD5_KMT2C_like 1429..1475 CDD:276988
PHD5_KMT2D 1506..1556 CDD:277074
HMG 2024..2075 CDD:197700
ePHD2_KMT2D 5035..5141 CDD:277168
FYRN 5185..5235 CDD:283589
FYRC 5243..5330 CDD:197781
SET 5416..5538 CDD:214614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.