DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31109 and Kmt2d

DIOPT Version :8

Sequence 1:NP_001262946.1 Gene:CG31109 / 43001 FlyBaseID:FBgn0051109 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_017172163.1 Gene:Kmt2d / 381022 MGIID:2682319 Length:5608 Species:Mus musculus

Alignment Length:138 Identity:28/138 - (20%)
Similarity:44/138 - (31%) Gaps:42/138 - (30%)


  Fly    92 KAQRNPSISSVESEEDVINSSSVHEFPNRNEEDQATRRSESTSTQAETGPQTQESQSPKSTKTAV 156
            :||:....|.|....|.:|...||      |..|.:.:.|........|.||.:.::......|.
Mouse  4440 EAQKPEQSSLVPGHLDQVNGQVVH------EPSQLSIKQEPREEPCALGAQTVKREANGEPAGAP 4498

  Fly   157 STPN--------SSESH-------------DASGAGP---------------SNRDRKETGTGNS 185
            .|.|        |...|             ..:|.||               |..::|..||.::
Mouse  4499 GTSNHLLLAGSRSEAGHLLLQKLLRAKNVQLGAGRGPEGLRAEINGHIDSKLSGLEQKLQGTSSN 4563

  Fly   186 ETGSTTRE 193
            :..:.||:
Mouse  4564 KEDAATRK 4571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31109NP_001262946.1 zf-AD 13..76 CDD:214871
Kmt2dXP_017172163.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.