DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31109 and Lpt

DIOPT Version :8

Sequence 1:NP_001262946.1 Gene:CG31109 / 43001 FlyBaseID:FBgn0051109 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_611847.2 Gene:Lpt / 37795 FlyBaseID:FBgn0263667 Length:1482 Species:Drosophila melanogaster

Alignment Length:213 Identity:38/214 (18%)
Similarity:75/214 (35%) Gaps:45/214 (21%)


  Fly     2 GSIEKA--CISGFLCRLCSEMHRTVIHIYSDHGQRLCLVEK--INGYLPITISPTDPLPK----- 57
            |.::|.  |:...:|..|.:         .:...||.|.::  |:.::.....|.:.:|.     
  Fly   567 GILQKGWRCLDCTVCEGCGK---------KNDEARLLLCDECDISYHIYCVNPPLETVPTGNWKC 622

  Fly    58 ---TICKSC----LHRVEQHYSLLMRLTRMREERKFKLIKYKAQRNPSISSVESEE-------DV 108
               |:|:.|    ..:.|...|.::.......:....:.|........|...|..|       |.
  Fly   623 SFCTLCQKCGRNPTEKSEFGDSNMLECPSCTSQSSCPVCKVSYSNGEMIIQCEHCELWAHFHCDS 687

  Fly   109 INSSSVHEFPNRNE----EDQATRRSESTSTQAETGPQTQESQSPKSTKTAVSTPNSSESHDASG 169
            :|:....:..:.|.    :.:.:.||.::...|:.|.:...:.:|:.:|..|        |..:.
  Fly   688 VNAQLTIDHYDNNVYKCFKCRCSTRSTNSLADAKFGNEDSLAITPQGSKPFV--------HITAS 744

  Fly   170 AGPSNRDRKETGTGNSET 187
            :||| .|.|.....|..|
  Fly   745 SGPS-FDSKSGAERNHPT 761

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31109NP_001262946.1 zf-AD 13..76 CDD:214871 13/77 (17%)
LptNP_611847.2 ePHD1_KMT2C_like 109..191 CDD:277135
PHD1_KMT2C_like 205..250 CDD:276984
PHD2_KMT2C_like 252..298 CDD:276985
PHD_SF 337..392 CDD:304600
PHD4_KMT2C_like 530..578 CDD:276987 3/11 (27%)
PHD5_KMT2C_like 580..625 CDD:276988 8/54 (15%)
PHD6_KMT2C_like 657..707 CDD:276989 7/50 (14%)
NHP6B 1101..>1237 CDD:227935
HMG 1173..1231 CDD:197700
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4443
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.