DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31109 and trr

DIOPT Version :8

Sequence 1:NP_001262946.1 Gene:CG31109 / 43001 FlyBaseID:FBgn0051109 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_726773.2 Gene:trr / 31149 FlyBaseID:FBgn0023518 Length:2431 Species:Drosophila melanogaster

Alignment Length:109 Identity:32/110 (29%)
Similarity:40/110 (36%) Gaps:27/110 (25%)


  Fly   106 EDVINSSSVHEFPNRNEEDQAT--RRSESTSTQAETGPQTQESQSPKSTKTAVS----------T 158
            ||....|.......||.:....  |.:..||...:.|..:..|.| .||.:.:|          .
  Fly   134 EDADKQSEYRISTPRNSQSNPLLHRNTAFTSFTKKEGASSSASSS-SSTASVISIEPSGSGQDHA 197

  Fly   159 PNSSESHD-------ASGAGPSNRDRKETGTGNSETGSTTREGT 195
            .||.:|.|       ||||..|      |..||| ||:.|..||
  Fly   198 ENSGKSEDLDYVLMPASGADSS------TSVGNS-TGTGTPAGT 234

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31109NP_001262946.1 zf-AD 13..76 CDD:214871
trrNP_726773.2 PHA03255 184..>320 CDD:165513 19/59 (32%)
ePHD2_KMT2C_like 1898..2002 CDD:277136
FYRN 2068..2118 CDD:283589
FYRC 2126..2215 CDD:197781
SET <2266..2431 CDD:225491
SET 2291..2413 CDD:214614
PostSET 2415..2431 CDD:214703
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4443
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.