DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31109 and kmt2d

DIOPT Version :8

Sequence 1:NP_001262946.1 Gene:CG31109 / 43001 FlyBaseID:FBgn0051109 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_017947166.1 Gene:kmt2d / 100494109 XenbaseID:XB-GENE-855725 Length:6131 Species:Xenopus tropicalis

Alignment Length:227 Identity:49/227 - (21%)
Similarity:79/227 - (34%) Gaps:64/227 - (28%)


  Fly    19 EMH----RTVIHIYSDHGQRLCLVEKINGYLPITISPTDPLPKTICKSCLHRVEQHYSLLMRLTR 79
            :||    |...|:..:|.:.....::.....|..: ||....|.  ||.    |:|..::     
 Frog  4833 QMHLQQLRQQAHLQIEHQEPKRKTQESTAVCPQPV-PTSQTTKN--KSS----EEHGGII----- 4885

  Fly    80 MREERKFKLIKYKAQR---------NP-SISSVESEEDVINSSSVHEF---------------PN 119
             :.|.....:|..:..         || |.||:|:.......|||||.               |.
 Frog  4886 -KPENNLAAVKLCSSNLSPPSRDGPNPDSSSSIEASSASPMLSSVHESDAKPANTASFLPKEQPK 4949

  Fly   120 RNE--EDQATRRSEST-----STQAETGPQTQESQSPKSTKT-AVSTPNSSESHDASGAGPS--- 173
            .:|  .|.:.::|.:|     .:|.|...|..||.:.|.:.| :::.|||...:......|.   
 Frog  4950 ESEPSNDISCQQSPATGDIHSDSQVEKPGQITESDAGKESNTKSLTNPNSHLENGEMADFPKFLK 5014

  Fly   174 ----------NRDRK-ETGTGNSETGSTTREG 194
                      .:|.| |....|:..|:.|..|
 Frog  5015 QEPIELGVSVQQDLKSEANCDNTSLGAKTEAG 5046

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31109NP_001262946.1 zf-AD 13..76 CDD:214871 13/60 (22%)
kmt2dXP_017947166.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.