DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smg6 and AT5G02650

DIOPT Version :10

Sequence 1:NP_651321.1 Gene:Smg6 / 42994 FlyBaseID:FBgn0039260 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_195885.4 Gene:AT5G02650 / 831848 AraportID:AT5G02650 Length:226 Species:Arabidopsis thaliana


Alignment Length:86 Identity:21/86 - (24%)
Similarity:35/86 - (40%) Gaps:10/86 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   777 DTNCFIDCLEDFEKLSTEFKRYTLIIPLTVVKELDGLSKGVKLDSYRSSKQTQRIHHFDEVSSRA 841
            |...|:..|.:.|.|:....|:...:.   :|..||.| .:.:|..|     :|:|..|.|....
plant   100 DPGPFLRFLRETEWLNENDHRHCFSLG---IKRGDGES-NLNVDLRR-----KRLHEPDGVHEAQ 155

  Fly   842 KKSLEFIKSAKGNVKCATTKG 862
            ..||.: :.:.|.:...|..|
plant   156 TLSLTY-QDSSGQLHVPTETG 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smg6NP_651321.1 EST1 219..298 CDD:463062
EST1_DNA_bind 310..639 CDD:431239
PIN_Smg6-like 767..941 CDD:350233 21/86 (24%)
AT5G02650NP_195885.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.