DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tnc and Rtn4

Sequence 1:NP_001247300.1 Gene:tnc FlyBaseID:FBgn0039257 Length:2819 Species:Drosophila melanogaster
Sequence 2:NP_114019.1 Gene:Rtn4 RGDID:620989 Length:1163 Species:Rattus norvegicus

Alignment Length:1158 Identity:259/1159 (22%)
Similarity:414/1159 (36%) Gaps:322/1159 (28%)


  Fly  1253 VDKKPIDESAEDKKP----------IGESEEDSKPIDESEEDKKPVEESAEDKKPVEDSEEKEKP 1307
            :|:..:..|:.|..|          :.|.|:     :|.||:::..||..||.:.:|..|.|   
  Rat     4 IDQSSLVSSSTDSPPRPPPAFKYQFVTEPED-----EEDEEEEEDEEEDDEDLEELEVLERK--- 60

  Fly  1308 LPTVIPASEIEKESKPEDEKKTEADFAAPTEQPEATTPAQIADTAEKEVDDKLATTSAPVSGEDE 1372
                 ||:.:...:.|........||::.:..|....|...|..|            ||     |
  Rat    61 -----PAAGLSAAAVPPAAAAPLLDFSSDSVPPAPRGPLPAAPPA------------AP-----E 103

  Fly  1373 LKPADEKKRTETAQIPDAEIPASTDEPESSTELPTVDLDKKPEEDSTKGTEAPESDKVPEVPTSA 1437
            .:|:.|:.       |.|..|:.   |.::..||:    |.||:|.      |.:...|..|..|
  Rat   104 RQPSWERS-------PAAPAPSL---PPAAAVLPS----KLPEDDE------PPARPPPPPPAGA 148

  Fly  1438 STENEIEESDKFTTVAPPKISAS---------DET---EPTAEEDLVPATFEPIESEFE-----V 1485
            |...|        ..|||...|:         |||   .|.|.|.::|::.|.|....|     |
  Rat   149 SPLAE--------PAAPPSTPAAPKRRGSGSVDETLFALPAASEPVIPSSAEKIMDLMEQPGNTV 205

  Fly  1486 STKK---PAV---QGPPLPTLAPAQPEK-------KPVDAETSTEADIS---TEPSAEVEKEAS- 1533
            |:.:   |:|   ....||:|:|.....       ..:.|.:|:|..|.   .|.|.|:.:.|: 
  Rat   206 SSGQEDFPSVLLETAASLPSLSPLSTVSFKEHGYLGNLSAVSSSEGTIEETLNEASKELPERATN 270

  Fly  1534 -------GETSESD-NEIDAGASSTPVPVSADEDKTPSTEKTVEADDKFTTVAPLA--------- 1581
                   .|.||.: :|:.:....:|...||...:....|..|.:.||...|...|         
  Rat   271 PFVNRDLAEFSELEYSEMGSSFKGSPKGESAILVENTKEEVIVRSKDKEDLVCSAALHSPQESPV 335

  Fly  1582 GDEEESNLPKLPQDIFEEEAPVAVTTAAPSKDD-GEQKPVEV--EEKPIEDGQKPIEDETSTPTS 1643
            |.|:....|:...|||.|   :.::..||.::: .:.||.|.  |.|...:|.:.:       .:
  Rat   336 GKEDRVVSPEKTMDIFNE---MQMSVVAPVREEYADFKPFEQAWEVKDTYEGSRDV-------LA 390

  Fly  1644 SENEIEPESDRATTIAPSKEEPSEPSTGAPTKDEPAEPSTDAPESDESKETPESEVPTTVAPAGE 1708
            :...:|.:.|| ..:..|.|:.|.........::.:.|||..|..|.|:               .
  Rat   391 ARANVESKVDR-KCLEDSLEQKSLGKDSEGRNEDASFPSTPEPVKDSSR---------------A 439

  Fly  1709 KIPTSSIT-PDEEPTATSAPVAKPDEDVEKETSTEIPTDAPASSEEDENSSTDQIPSEVPEKKPE 1772
            .|..:|.| ..|..||.:.|:.   ||...|..|:         |:.......||.:|....|..
  Rat   440 YITCASFTSATESTTANTFPLL---EDHTSENKTD---------EKKIEERKAQIITEKTSPKTS 492

  Fly  1773 TP---AQTPEEGDIVGATAAPTTSDEVPPVQRLPEEVLAEIPQPSTETGIKQQDETTAAPSIDRK 1834
            .|   |....|.|.|........::..  |..:||.:..::.|.:.|:.:.:...|..|      
  Rat   493 NPFLVAVQDSEADYVTTDTLSKVTEAA--VSNMPEGLTPDLVQEACESELNEATGTKIA------ 549

  Fly  1835 EPYVTEIDEEATTVAPISEKDEKPTEEEKPVEQK-PTGEEPSEEEEKEKPIEQDVSTEGPVSTEA 1898
              |.|::|        :.:..|...|...|..|. |:.|   |.|....|:..|:..|.|:::..
  Rat   550 --YETKVD--------LVQTSEAIQESLYPTAQLCPSFE---EAEATPSPVLPDIVMEAPLNSLL 601

  Fly  1899 SEAG------STESSEEVKPSTEGEVAEKPEDKQPSSTAQ-------APVETI--PEISTELPAQ 1948
            ..||      |....|...|.:...:..:||:..|...|.       ...|.|  || |.....|
  Rat   602 PSAGASVVQPSVSPLEAPPPVSYDSIKLEPENPPPYEEAMNVALKALGTKEGIKEPE-SFNAAVQ 665

  Fly  1949 DGDKPTSEAPVDSDEDTSAPSDEKIPSVSGEEVEGPEVTTASPQAAEEDELKTPAESEP---SST 2010
            :.:.|......|..::|.. |.|..|..|... |..:...:.|:.||..|..:| ||||   .|.
  Rat   666 ETEAPYISIACDLIKETKL-STEPSPDFSNYS-EIAKFEKSVPEHAELVEDSSP-ESEPVDLFSD 727

  Fly  2011 DKVPETEYQKPEDETKADE-TPESVTQVSDVATSTSAPVAGGDIEKDEQATTASPEE-----EEE 2069
            |.:||.    |:.:.:|.. ..||:|:||:...           :..|:..:|||:|     .|.
  Rat   728 DSIPEV----PQTQEEAVMLMKESLTEVSETVA-----------QHKEERLSASPQELGKPYLES 777

  Fly  2070 IKPTI-----APAAEIPQPSEKEPVDEQEVESGT----------------KATPAESDGQPIDEI 2113
            .:|.:     |.:.:||..::||.:..|..|..|                |.:...||..|| ||
  Rat   778 FQPNLHSTKDAASNDIPTLTKKEKISLQMEEFNTAIYSNDDLLSSKEDKIKESETFSDSSPI-EI 841

  Fly  2114 APATSGPIDEASTAAPTKEESTTVASAASPAVHDDEIKDVTTTQPVADEKEVA------------ 2166
                   |||..|....|::|..:|            |:.|..: |:|:.|:|            
  Rat   842 -------IDEFPTFVSAKDDSPKLA------------KEYTDLE-VSDKSEIANIQSGADSLPCL 886

  Fly  2167 -----------APQDETKTSIDVSTDSPTAQDDEKQDKTEAPVAPTTVSSPTADSAADSSTPTVE 2220
                       .|:||...|.:.|        :.:...::|.::|:.||:               
  Rat   887 ELPCDLSFKNIYPKDEVHVSDEFS--------ENRSSVSKASISPSNVSA--------------- 928

  Fly  2221 VPSPVEIDTKPMDDIMSQTIAPHTADGAASTSTEDEDQAPVTVSPQDAEKTPV 2273
                :|..|: |..|:........|:....:.||.||::...|...:..||.|
  Rat   929 ----LEPQTE-MGSIVKSKSLTKEAEKKLPSDTEKEDRSLSAVLSAELSKTSV 976

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tncNP_001247300.1 VWC 235..296 CDD:214564
PHA02664 <433..595 CDD:177447
Ehrlichia_rpt 529..1065 CDD:118064
DUF863 <1684..>1788 CDD:283539 24/108 (22%)
VWC 2762..>2805 CDD:302663
Rtn4NP_114019.1 Reticulon 976..1140 CDD:280592 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.