DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tnc and Cmya5

Sequence 1:NP_001247300.1 Gene:tnc FlyBaseID:FBgn0039257 Length:2819 Species:Drosophila melanogaster
Sequence 2:NP_076310.2 Gene:Cmya5 MGIID:1923719 Length:3676 Species:Mus musculus

Alignment Length:3008 Identity:650/3009 (22%)
Similarity:1024/3009 (34%) Gaps:837/3009 (28%)


  Fly   198 ENELDFMDQSTTTTTTTVRPTTGFILASTMTPPTTTDCIHDGEIFADGASLKGKNACEHCYCMRG 262
            |||    ..|..|...|.|..|     ::.|||.|            ||..|     ||...:..
Mouse   180 ENE----KSSIGTYDKTRRKKT-----ASNTPPIT------------GAIYK-----EHKPLVLK 218

  Fly   263 DIVCAVQECEVPMMAANGKSCRAMPAAEGECCPSNYVCEDDSSTTEIVEITTPESATSVPAKGIH 327
            .:.....:.::.|.  |......:|.......|..||                       .|.||
Mouse   219 PVYIGTVQYKIKMF--NSVKEELIPLQFYGTLPKGYV-----------------------IKEIH 258

  Fly   328 AEIPKEDVDLQEHIDDDDKNKETATIPSAELGSGEIEEEEEEKDKATTVAP------VQVTDEKD 386
            ....|   |....::.|..|..:..:|..:|.      :..|:||...:||      .:.:....
Mouse   259 YRRGK---DSSISLEPDLSNGGSNIVPQRKLA------QSPEEDKVRELAPPWRGALSKGSRTSL 314

  Fly   387 FSFEPESSTAGIPSDSRIDLPSSTEESKESSTEAAEEDIVKIVTTPE--PEGSGEEDVP---KPS 446
            ||.|.:..|.   :||.:::|||||.:..||......|..:.::.|:  |:...:|...   :|.
Mouse   315 FSHEEQKKTY---ADSNLNVPSSTEHAFPSSARNDTADQEENLSLPQMMPQQPADESKTHRMEPP 376

  Fly   447 QIPEKEITEDELIKVSTSAPAKASPEEEVVTATTSAPTEEDVKPTTAGTIS-----------EEE 500
            .||...:.|....::..:|..|.|.|::....|.||   :||:  ..|.:|           |..
Mouse   377 SIPATMVLERAKEELEQNAQGKESSEDDASVLTGSA---DDVQ--QEGLVSVNHSMPWEAEKESL 436

  Fly   501 EEGKPTPAEEGSGEEEKDVK----VTAAPEETEDEAKPTSAPVASDEKEQEPKPSEGSGDEELDL 561
            |.|.|.||.....:.|.|::    ::....|...|...:|.|:...|:|..|:|.....:|.   
Mouse   437 ETGPPRPAPAIQEKFEPDMEGLEPISTEKTEQASEYVTSSEPIVHREEEHAPEPIVHREEEH--- 498

  Fly   562 KPTTAPTAGATSASEESEEQDEGKSTE-APTSVDDIEPAKPTESSEEASGEGEDVAKETTPAGEA 625
                ||........|.:.|....:..| ||.|:...|.....||..:..       :|..|..|:
Mouse   499 ----APEPIVHREEEHAPEPIVHREEEHAPESIVHREEEHAPESIVQRE-------EEHAPEPES 552

  Fly   626 SIAGEEEIVKGTTPAGEPSSEGDEEIVKGTTPAEESSSE---SEDELTKVTTPAGEPSVAGEEE- 686
            .:..|||...|..|......|...|:.......||.:.|   ..||     ..|.||.|..||| 
Mouse   553 IVHREEEHAPGPVPIVHREEEHVPELESIVHRGEEHAPEPIVHRDE-----GHAPEPIVHREEEH 612

  Fly   687 -----IAKETTPAGEPSIAGEEEIVKVTTPAGESSIAGEEEI---------------VKVTTPAG 731
                 :.::...|.||.:..|||.|    |..||.:..|||.               |:.:||..
Mouse   613 VPEPIVHRDEGHAPEPIVHREEEHV----PEPESIVHREEEHAPEPMVLRKAQLERGVETSTPIT 673

  Fly   732 ESS----SEGEEEIIKVTTPAGESSSEGDEEIVKESTPAGEPISEGEEDVIKATTSAPKSDIEGV 792
            :::    |..|||||::..|....:|       ||::|:  |:|               .::|..
Mouse   674 DTTEPEDSSLEEEIIELDYPESPLAS-------KETSPS--PLS---------------PEVEHR 714

  Fly   793 KEPETATEVPAEEVEDFAKPTTP--IAEAEEEPIAGTPIPTDGISGEEEIV---KGTTPQTLE-E 851
            |||...|::          ..||  |..:|||......:.||.....|..|   ...||:.|| |
Mouse   715 KEPILPTQM----------TFTPERITLSEEEREENESVSTDSAFVSEYSVLQDLNHTPEKLEVE 769

  Fly   852 QPEISE-ESTEVPV--AEDDLSSSTSASAIAS-STEGVQDAASETTSS---------APARAGDK 903
            ...:|: :|:..|.  :|||....:.:.|:.| |.:.:..:.:|.||:         :|..:|  
Mouse   770 AVSVSDVKSSNEPAVFSEDDEERESYSPAMTSVSEQSLSPSTTEKTSAIQSPLFSTVSPVLSG-- 832

  Fly   904 DEAATTV---PTAQDKDDEEVEQDATDLPVEDVVQSTTAKTTTTEQPKEESSTEAEDAEIEVTTS 965
            |||:.:|   |.::...:..|...|.:|    ::::...|.....|...|...:|||.:.::...
Mouse   833 DEASESVCHSPESESAAEYSVPAHAQEL----LLKTGDHKLPLKSQRVSEPIIQAEDEKEDIGLL 893

  Fly   966 SPADKQEVPEAEPADKDHKDEEDVQTATDLPIKSDIGPPVVDTEATTGQPETSDETATDKPPSVY 1030
            .||   .:.:|..::.:........:.:.||.|     |.|...||...|:   :|..|.|   .
Mouse   894 PPA---ALSQAVLSEDESLGSGSFASDSKLPFK-----PSVSQNATRESPQ---KTIDDMP---Q 944

  Fly  1031 LPPGGEKD----TEKEDETTATEPSVQEEPSKPVDISPVSQEVPSSTAKVDNRNDFETEKPTLPP 1091
            ..|.|..|    .|:|.|......|...|      :|.|...:|..|.::.:    |:..|  ||
Mouse   945 FKPRGLSDPATLLEEEKEAIGVGLSSSNE------VSAVECALPPQTTELLS----ESHAP--PP 997

  Fly  1092 -------------SGEDQ-----SSEP---------LPAMDLPAGIPGEGDCLVEGKTYANNTIV 1129
                         ...||     ||.|         |.....|.|:..:|.        ..:.|.
Mouse   998 WAISSEQVVQSEEGSRDQQRGSFSSTPELGHTSPLLLKGASSPTGLSEQGQ--------EEDNIG 1054

  Fly  1130 PATAPCDVSCKCISSLVACQQMECKLP-ENLEKCTVAAD----LLDGCCPTYICDESTESAEKDE 1189
            |.:.         .|..|.:......| :.|||..:..|    |......|.:.||.||.|:...
Mouse  1055 PLSP---------DSAFASEFSFSPYPTQELEKRELGRDSPLCLTSPSEQTVLSDEDTEEADLFS 1110

  Fly  1190 ESTAK------------PDNKIDED-------------VSEISTEEIPKDVIMPTGITEQPLSHV 1229
            ..:|.            ..||::.|             .||...||....|:.|..      .|.
Mouse  1111 PDSASQVSIPPYRIAETEQNKVEPDELLPRRSAPDYPYFSEADEEEAGSSVVTPVP------EHS 1169

  Fly  1230 KPDEEIQPVTSVPAQFDE-STTAKVDKKPIDESAEDKKPIGESEEDSKPIDESEEDKKPVEESAE 1293
            :|.:|.:..:.....|:: |.....||....|:..|...|..|..:...:.:.|:.:..:|..||
Mouse  1170 EPSQEREESSPCRPVFEDLSLLPSADKTGQAETMSDVPTISTSVSEYLILAQQEKTQASLEPEAE 1234

  Fly  1294 DKKPVEDSEEKEKPLPTVIPASEIEKESKP-EDEKKTEADFAAPTEQPEATTPAQIADTAEKEVD 1357
            |..|...|..:::...:.:||..|...|.. ....|.|.....||.||..:..:......|:|..
Mouse  1235 DLVPPPTSGWEKRDAKSSLPAVTIAASSSALSSVVKEETTSVLPTSQPSVSPESTCVLKPEQEPT 1299

  Fly  1358 DKLATTSA------PVSGEDEL----------KPADEKKRTETAQIPDAEIPAST-----DEPES 1401
            ..|..|||      |..|.::.          |..|:........:|.:.:..|.     |||::
Mouse  1300 APLTLTSADEQMALPRVGREKAVLDSQEATAHKSQDQTPEPRLPNVPGSGMKYSVLSDLGDEPKA 1364

  Fly  1402 STEL---PTV--DLDKK---------------PEEDSTKG--------TEAPESDKVP-EVPTSA 1437
            ..:|   |||  :|:::               |||.|..|        ||..:..|:. |:|.::
Mouse  1365 DVKLNLAPTVTSELEQRMLSKNEPEVAKPHSPPEETSISGPKVLSAVKTEVKQESKITRELPAAS 1429

  Fly  1438 STENEIEESDKFTTVAPPKISA-----SDETEPTAEEDLVPATFEPIESEFEVSTK--------K 1489
            |..   |...:.:..|||.:.|     ..:||.::....||.|  .::|.   |||        .
Mouse  1430 SGR---ERGAEHSPPAPPALPALMEEMGKDTEASSSATTVPVT--KLDSN---STKLGRDEVLTD 1486

  Fly  1490 PAVQGP------------------PLPTLAPAQ---PEKK-PVDAETSTEADISTEPSAEVEKEA 1532
            |::..|                  |||:::.::   ||.| ||::            ..|||:| 
Mouse  1487 PSLASPVEHPGLKGVGKSELGSGLPLPSMSTSEVLRPEPKLPVNS------------GVEVERE- 1538

  Fly  1533 SGETSESDNE---IDAGASSTP-VPVSADED--KTPSTEKTVEAD----------------DKFT 1575
                   |||   :....:|.| ||....|:  ::|.:|..|..|                ::.:
Mouse  1539 -------DNEPPPLQVSPTSKPTVPNDKHEEITRSPDSENVVSDDLAPTLLALRHEMNRQAEETS 1596

  Fly  1576 TVAP---LAGDEEESNLPKLPQDIFE-EEAPVAVTTAAPSKDDGEQ------KPVEVEEKP--IE 1628
            :..|   |:|::|...||..|:...: .|.|.|.:....|:|....      ||:..|..|  :|
Mouse  1597 SPVPGSFLSGEQELIKLPPEPEKHKQLSEVPTAGSELIDSRDRDRSLGIEPVKPIGTEPGPSILE 1661

  Fly  1629 DGQ-------KPIEDETSTPTSSENEIE----------PESDRATTIAPSKEEPSEPSTGAPTKD 1676
            .|.       |..|:....|..:...:|          .|..|......:.|.|.|.|:.|   |
Mouse  1662 KGPAELQRRGKEQEENRKLPVPASAPLETASFDLPIEQKEPKRTLHEGQAVEVPDESSSSA---D 1723

  Fly  1677 EPAEPSTDAPESDESKETPESEVPTTVAP-AGEKIPTSSITPDEEPTATSAPVAKPD------ED 1734
            :|........|..|:.|.|:..|.|..|. .|.|:..|.|:|.:    .:..:.|||      ||
Mouse  1724 KPELGVKQLAEKKENLEQPKPFVTTERASVTGSKVKESLISPKD----NTWMLEKPDGLVNQHED 1784

  Fly  1735 -------VEKETSTEIPTD----APASSE---EDENSSTDQIP------SEVPEKKPETPAQTPE 1779
                   :|...||::.::    ||..::   |..|..|.:.|      |:.|.:.........|
Mouse  1785 RKPGTGQLESSESTDLMSEKLGAAPLDTDHTSETRNQETSKAPVSGEKLSQEPRRVQSKAVDDSE 1849

  Fly  1780 EG-----------------DIVGATAAPTTSDEVPPVQRLPEE--VLAE--IPQPSTETGI---- 1819
            ||                 ..|.|.|.| ...|.|.|.:.|.|  ::.|  :|....:.||    
Mouse  1850 EGRKLASGNVEVLTQSKSVPAVKAKATP-QPPETPEVTQKPSEKSLVTEQGLPAEKGKKGISSFK 1913

  Fly  1820 ---------------KQQD----ETTAAPSIDRKEPYVTEIDEEATTVAPISEKDEKPTEEEKPV 1865
                           |..|    ||...||:::..|   .|:.:.|..|.::.. |||.....|.
Mouse  1914 SWMSSLLFGSSIPDSKVSDNEDLETRPGPSVEKAVP---AIEPKGTVPAEVNIA-EKPAVHSLPE 1974

  Fly  1866 EQKPTGEEPSEEEEKEKPIEQDVS------------------------------TEGPVSTEASE 1900
            ......|||.....|.. |.||:.                              :||...:.|:.
Mouse  1975 VTVKLAEEPKGVSVKSS-ISQDLKEKLTFLSNEDVLKQPKSNSENYGQKELPGFSEGMGESLATS 2038

  Fly  1901 AG----------------STESSEEVKP--STEGEVAEKPE------------DKQPSS------ 1929
            .|                ..|.::.:.|  .||.:..:|||            .::|||      
Mouse  2039 VGDKHPGIHPCSPMGEKVGMEEAQNMAPLHITESQRRQKPEVSSPSMWNISARKEEPSSDHKETW 2103

  Fly  1930 -TAQAPVETIPE-----------ISTELPA---------------------QDGDKPTSEAPVDS 1961
             ::...|:.:|:           :::|.||                     |:..||||..  ..
Mouse  2104 LSSSDVVDRMPQKPKSAQSAFTRMNSEEPASMILPVESKGSLSDLGEDRLRQEMPKPTSLE--HC 2166

  Fly  1962 DEDTSAPSDEKIPSVSGEEVEGPEVTTASPQA----AEEDELKTPAESEPSST----DKVPETEY 2018
            :|:...|::||         :|.|..:.|...    ||:.|:..|.|...:..    .::||:..
Mouse  2167 EEEVERPTEEK---------DGWETRSFSLAGKRGLAEKQEIMAPLELRENEAVGELQRMPESRP 2222

  Fly  2019 QKPEDETKADETPESVTQVSDVATSTSAPVAGGDIEKDEQATTASPEEEEEIKPTIAPAAEIPQP 2083
            .|.|:...|:...:.::....:....|..:|....||:.|....|..|::|..|...|   :|..
Mouse  2223 FKLEESKAAERLEQRISPTEKLMEKPSKTLALDRREKEVQEWVFSEGEKQEYPPAAMP---VPGA 2284

  Fly  2084 SEKEPVDEQEVESGTKATP-AESDGQPIDEIAP---------ATSGPIDEASTAAPTKEESTTVA 2138
            |... :|:.:.....|.|| .|.....:.|:.|         ....|.:|..|..    |.|.|:
Mouse  2285 SAVS-LDKAQPHLLAKPTPVVEKPEHIVTEVYPEIRERKAAETQPHPQEEGKTLV----EKTKVS 2344

  Fly  2139 SAASPAVHDDEIKDVTTTQPVADEKEVAAP-----QDETKTSI--DVSTDSPTAQDDEKQDKTEA 2196
            ...||  |.:|....:.||....|.|.:..     ::|.:..:  ::|..:..|.:|       .
Mouse  2345 RVESP--HGEETDGHSLTQEGNLELEKSGESRVDLKEERRRFVMPELSLGASVAAED-------G 2400

  Fly  2197 PVAPTTVSSPTA------DSAADSSTPTVEVPSPVEIDTKPMDDIMSQTI----------APHTA 2245
            .|.|..:|...|      |......||..: ||.||..|..:...:..|:          ..||.
Mouse  2401 SVQPRPLSKDAARVSDMTDETKHLGTPPTQ-PSAVEPQTLVLGTSVEHTVKKQETWSDRPTVHTF 2464

  Fly  2246 DGAASTSTEDEDQAPVTVSPQDAEKTPVSPAPQD--SDKTPSSEAPQ------DADEIPATATPL 2302
            . .:...||:..:..|.:|....|      |.:|  .::.|||.|..      .|.||.|...| 
Mouse  2465 Q-TSKDYTEEMLKQSVLISKHHLE------AVEDVHRNEPPSSAASNYTQFMLSASEISADGVP- 2521

  Fly  2303 DDNKIPATVAPQTDDGVPATAAPLDEDKIQTTAAPLDEEKIPSTAAPLDDE-----KIPAPVSPV 2362
                 |.....|..:|   |:...:|..:.:..|.|.|::  .:|..:..|     .|.||....
Mouse  2522 -----PMGGTAQEPEG---TSVKDEEFSVTSKPAGLSEDQ--KSAFSIISEGCEILNIHAPAFIP 2576

  Fly  2363 VFDVEPSSEKPAVSEYDGEEST--EPPVHD-VETSTDEPTSDAKLKPP----TSAPATPS-ESPA 2419
            ..|.|.|.:.....:|..|:::  ...||| .:.:....|..:||:.|    ||.....: |:..
Mouse  2577 SVDQEESEQMQDKLQYLEEKASFKSISVHDEKKAAASHKTQKSKLEVPDRKITSLKENETKETHK 2641

  Fly  2420 TEAEIVPETAAPELEKEVPEKATEQPELEKETPEKATEQPELEKETPEKATEQPELEKETPEKAT 2484
            |:.||..::...:.....|..:.|:...||.|.......|...|            :|.|.|:::
Mouse  2642 TKEEIATDSGMGDFTPIQPTVSGEEDYFEKYTLIDYNLSPGSGK------------QKSTVEESS 2694

  Fly  2485 EQPELEKEVTDKATEQPESVDEKTTPEPVVKPSLDST----EEDEESVESEE-------ESADKK 2538
            |      |.|...|..|||..|:..........||.:    |:|:..:...|       :..|.:
Mouse  2695 E------EATKTLTSFPESSAEQALDHEYNLVKLDESFYGPEKDDSKLSHAEMQKSLAIQKPDDR 2753

  Fly  2539 DKNKETEEDTDKKHEEPEVPAV-VSEIPQPSEEAVPTTGHPLFPHLASSTTTPPAVD-------D 2595
            :..|....|.|.:  .|.:|.. |.|......:..|||...:.|.|...   |||:.       :
Mouse  2754 NAPKGISRDVDSR--SPGMPLFDVEEGVLSKRQIFPTTPKAVNPELLEE---PPALSFFYKDLYE 2813

  Fly  2596 RVGEEDEENTTVKLSSSTTTSTT----ESPVTSAP---------------STTTVASQQQQPITP 2641
            ..|.|..|..|.....|..:.|:    .|.....|               ..|.....|.|.:..
Mouse  2814 GAGGEKNEGETASEGDSVDSETSFPRRHSDTDDGPGMYFEKYILKDDILHDETVTQEDQGQGLEE 2878

  Fly  2642 PPYGHAPEYEDEYDEEEV 2659
            .|.|.....:....|.|:
Mouse  2879 KPVGEEDSQQLRVAEREI 2896

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tncNP_001247300.1 VWC 235..296 CDD:214564 9/61 (15%)
PHA02664 <433..595 CDD:177447 42/183 (23%)
Ehrlichia_rpt 529..1065 CDD:118064 141/591 (24%)
DUF863 <1684..>1788 CDD:283539 33/148 (22%)
VWC 2762..>2805 CDD:302663
Cmya5NP_076310.2 iSH2_PI3K_IA_R 3153..3277 CDD:304922
FN3 3321..3409 CDD:238020
FN3 3416..3502 CDD:238020
SPRY 3504..3666 CDD:295394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.625 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.