DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tnc and rtn1b

Sequence 1:NP_001247300.1 Gene:tnc FlyBaseID:FBgn0039257 Length:2819 Species:Drosophila melanogaster
Sequence 2:NP_001315200.1 Gene:rtn1b ZFINID:ZDB-GENE-030710-3 Length:767 Species:Danio rerio

Alignment Length:706 Identity:157/707 (22%)
Similarity:244/707 (35%) Gaps:207/707 (29%)


  Fly  1265 KKPIGESE-----EDSKPID--------------ESEEDKKPVEESAEDKKPVEDSEEKEKPLPT 1310
            :||..:||     ||.:.||              |..:.:...:||:.:|:.....|...:|||.
Zfish     3 EKPEADSEGSWYGEDFEKIDRFGRTSSARRDVLGEERQTRDWEDESSVEKQFSSHPESDRQPLPV 67

  Fly  1311 VIPASEIEKESKPEDEKKTEADFAAPTEQPEATTPAQIADTAEKEVDDK------LATTSAPVSG 1369
            |:..:..:|.:                            .:.:|..||:      |.:.....|.
Zfish    68 VMETASTDKST----------------------------SSIQKSSDDRDDLYTSLLSNQHYSSH 104

  Fly  1370 ED------ELKPADEKKRTETAQIPDAEIPAS---TDEPESSTELPTVDLDKKPEEDSTKGTEAP 1425
            ||      .|..:.:|..|.|    |..|..|   |...:||.::.|                  
Zfish   105 EDTSYFSGSLSKSADKHTTHT----DDFISGSYSVTFSSDSSNKIKT------------------ 147

  Fly  1426 ESDKVPEVPTSASTENEIEESDKFTTVAPPKISASDETEPTAEEDLVPATFEPIESEFEVSTKKP 1490
               ...::.:|.|||.....|..:.     .||..|::.         ::..|:| ::.:|    
Zfish   148 ---STDQIDSSHSTERAFGSSYNYM-----DISGKDDSR---------SSQRPLE-DWSMS---- 190

  Fly  1491 AVQGPPLPTLAPAQPEKKPVDAETSTEA---DISTEPSAEVEKEASGETSESDNEID-------- 1544
            .:..|.|.|.....|....|||:....|   |..|.|..|         ..||.|:.        
Zfish   191 GLSEPSLYTKLEKSPSPVEVDADELGSAGLLDTQTFPYVE---------EPSDEELSDYQPYRSP 246

  Fly  1545 -AGASSTPVPVSADEDKTPSTEKTVEADDKFTTVAPLAGDEEESNLPKLPQDIFEEEAPVAVTTA 1608
             .|:|::||.::..|....|...|........||:     ::||.|     .:..|..| .||.:
Zfish   247 GTGSSASPVRITLTEIPPTSVSPTTIQHSPTVTVS-----QKESIL-----SLGLEGMP-TVTLS 300

  Fly  1609 APSKDDGEQKPVEVEEKPIEDGQKPIEDETSTPTSSENEIE---PESDRATTIAPSKEEPSEPST 1670
            .|..|..|.     ...|.||.:.|::....   :.|.||.   |:|.:|:||.|:  :|:....
Zfish   301 EPEDDSPES-----STPPTEDSESPMDPNIQ---AGETEIMNSIPDSTQASTIPPA--QPASKKD 355

  Fly  1671 GAPTKDEPAEPSTDAPESD----ESKETPESEVPTTVAPAGEKIPTSSITPDEEPTATSAPVAKP 1731
            .:|.::..|..||..|.|.    .|.|:.:||:.........:.|:|......:..||:.|    
Zfish   356 SSPVENMSAPKSTLPPTSQGFEGNSAESGDSEIELVSEEPSPRAPSSGYMSFSKTPATALP---- 416

  Fly  1732 DEDVEKETSTEIPTDAPASSEEDENSSTDQIPSEVPEK----KPETPAQTPEEGDIVGATAAPTT 1792
                     |.:.:.||..      |||..||..:..:    :.|..|:...|      .|..:.
Zfish   417 ---------TIVASTAPVP------SSTTAIPKSLALQYSILREEREAELDSE------LALESC 460

  Fly  1793 SDEVPPVQRL---PEEVLAEIPQPSTETGIKQQDETTAAPSIDRKEPYVTEIDEEATTVAPISEK 1854
            .:|.|  :||   ..:...||||     .:|:....|:|    .|||:||......|.:||.|..
Zfish   461 GEESP--KRLTHGSSKRYKEIPQ-----AVKKPTSPTSA----TKEPFVTSTTPSTTILAPTSAS 514

  Fly  1855 DEK-PTEEEKPVEQKPTG--------EEPSEEEEKEKPIEQDVSTEGPVSTEASEA 1901
            .|| .|.||||.......        |.|:.|..|::......:..|...|.|..|
Zfish   515 KEKMSTMEEKPKHSTILSPGLPELKVEHPAGEVHKKERRRSSQARRGSEKTSAPPA 570

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tncNP_001247300.1 VWC 235..296 CDD:214564
PHA02664 <433..595 CDD:177447
Ehrlichia_rpt 529..1065 CDD:118064
DUF863 <1684..>1788 CDD:283539 22/112 (20%)
VWC 2762..>2805 CDD:302663
rtn1bNP_001315200.1 Reticulon 582..744 CDD:280592
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.