DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tnc and EHBP1L1

Sequence 1:NP_001247300.1 Gene:tnc FlyBaseID:FBgn0039257 Length:2819 Species:Drosophila melanogaster
Sequence 2:XP_006718549.1 Gene:EHBP1L1 HGNCID:30682 Length:1535 Species:Homo sapiens

Alignment Length:1704 Identity:356/1705 (21%)
Similarity:546/1705 (32%) Gaps:507/1705 (30%)


  Fly   322 PAKGIHAEIPKEDVDL------QEHIDDDDKNKETATIPSAELGSGEIEEEEEEKDKATTVAPVQ 380
            |.:|....:..|:||:      ..|:|..:..:.|..|.:...|..:: ....|.|.|....||.
Human    65 PYRGTVVWMVPENVDISVTLYRDPHVDQYEAKEWTFIIENESKGQRKV-LATAEVDLARHAGPVP 128

  Fly   381 VTDEKDFSFEPES----------STAGI----------------------PSD--SRIDLPSSTE 411
            |........:|:|          :.:|:                      |||  :..|...|.|
Human   129 VQVPVRLRLKPKSVKVVQAELSLTLSGVLLREGRATDDDMQSLASLMSVKPSDVGNLDDFAESDE 193

  Fly   412 ESKESSTEAAEEDIVKIVTTPEPEGSGEEDVPKPSQIPE-----KEITEDELIKVSTSAPAKASP 471
            :  |:....|.|...::   |:|   |.....:|.:.|:     |.:.|:|.........|.|||
Human   194 D--EAHGPGAPEARARV---PQP---GRGGALRPGRFPDPSRELKTLCEEEEEGQGRPQQAVASP 250

  Fly   472 E--EEVVTATTSAPTEEDVKPTTAGTISEEEEEGKPTPAEEGSGEEEKDVKVTAAPEETEDEAKP 534
            .  |:...|..|||...  ..|:.|..||...|.......|.....|...::.::.:..:|.| |
Human   251 SNAEDTSPAPVSAPAPP--ARTSRGQGSERANEAGGQVGPEAPRPPETSPEMRSSRQPAQDTA-P 312

  Fly   535 TSAP---VASDEKEQEPKPSEGSGDEELDLKPTTAPTAGATSASEESEEQDEGKSTEAPTSVDDI 596
            |.||   ..||..    :|....|::|:. |.:.||.||..||.|...:....:.|||       
Human   313 TPAPRLRKGSDAL----RPPVPQGEDEVP-KASGAPPAGLGSARETQAQACPQEGTEA------- 365

  Fly   597 EPAKPTESSEEASGEGEDVAKETTPAGEASIAGEEEIVKGTTPAG----EPSSEGDEEIVKGT-- 655
            ..|:...|.|: .|.|:       |.|...:..||...:....|.    ||.|.|.|...|.:  
Human   366 HGARLGPSIED-KGSGD-------PFGRQRLKAEEMDTEDRPEASGVDTEPRSGGREANTKRSGV 422

  Fly   656 --TPAEESS------SESEDELTKVTTPAGEPSVAGEEEIAK-ETTPAGEPSIAGEEEIVKVTT- 710
              ..|||||      :|...::..|.|..  |...|....|: ..||...|  .|.:..:.|.| 
Human   423 RAGEAEESSAVCQVDAEQRSKVRHVDTKG--PEATGVMPEARCRGTPEAPP--RGSQGRLGVRTR 483

  Fly   711 ---PAGESSIAGEEEIVKVTTPAGESSSEGEEEIIKVTTPAGESSSEGDEEIVKESTPA--GEPI 770
               |:|.|....|        |||.|...|:.|..:..  ||: ..||.|  |:...|.  |..:
Human   484 DEAPSGLSLPPAE--------PAGHSGQLGDLEGARAA--AGQ-EREGAE--VRGGAPGIEGTGL 535

  Fly   771 SEGEEDVIKATTSAP------------------------KSDIEGVKEPETATEV--------PA 803
            .:|..  :.|.::.|                        :::..|..:.||.|||        ..
Human   536 EQGPS--VGAISTRPQVSSWQGALLSTAQGAISRGLGGWEAEAGGSGDLETETEVVGLEVLGTQE 598

  Fly   804 EEVEDFAKPTTPIAEAE-----EEPIAGTPIPTDGISGEEEIVKGTTPQTLEEQPEISEESTEVP 863
            :|||....|.|...|.|     |:..|.:.:....::|..:.      :.||.|      .|||.
Human   599 KEVEGSGFPETRTLEIEILGALEKEAARSRVLESEVAGTAQC------EGLETQ------ETEVG 651

  Fly   864 VAEDDLSSSTSASAIASSTEGVQDAASETTSSAPARAGDKD--EAATTVPTAQDKDDEEVEQDAT 926
            |.|               |.|.:   :|...:....||...  :..||:...:....:|:..|..
Human   652 VIE---------------TPGTE---TEVLGTQKTEAGGSGVLQTRTTIAETEVLVTQEISGDLG 698

  Fly   927 DLPVEDVVQSTTAKTTTTE-----QPKEES-STEAEDAEIEVTTSSPADKQEVPEAEPADKDHKD 985
            .|.:||.:||....|..||     .|:.|: .|||:....:..|:..:..:|: |||.|      
Human   699 PLKIEDTIQSEMLGTQETEVEASRVPESEAEGTEAKILGTQEITARDSGVREI-EAEIA------ 756

  Fly   986 EEDVQTATDLPIKSDIGPPVVDTEATTGQPETSDETATDKPPSVYLPPGGEKDTEKEDETTATEP 1050
            |.|:..|.::.: ..:|...::|.|..|....:.|.|: :...|   ||.|.||        |..
Human   757 ESDILVAQEIEV-GLLGVLGIETGAAEGAILGTQEIAS-RDSGV---PGLEADT--------TGI 808

  Fly  1051 SVQEEPSKPVDISPVSQEVPSSTAKVD--NRNDFETEKPTLPPSGEDQSSEPLPAMDLPAGIPGE 1113
            .|:|.....|      .|:.:.||:.:  ...:..:....:|    ...||...|.:...|  |.
Human   809 QVKEVGGSEV------PEIATGTAETEILGTQEIASRSSGVP----GLESEVAGAQETEVG--GS 861

  Fly  1114 GDCLVEGKTYANNTIVPATAPCDVSCKCISSLVACQQMECKLPENLEKCTVAADLLDGCCPTYIC 1178
            |   :.|         |.....:      :.::..::.|..:||                     
Human   862 G---ISG---------PEAGMAE------ARVLMTRKTEIIVPE--------------------- 887

  Fly  1179 DESTESAEKDEESTAKPDNKIDEDVSEISTEEIPKDVIMPTGITEQPLSHVKPDEEIQPVTSVPA 1243
                  |||:|..|:..........|.:..|.:...|..|..:..|     :...||..|     
Human   888 ------AEKEEAQTSGVQEAETRVGSALKYEALRAPVTQPRVLGSQ-----EAKAEISGV----- 936

  Fly  1244 QFDESTTAKVDKKPIDESAEDKKPIGESEEDSKPIDESEEDKKPVEESAEDKKPVEDSEEKEKPL 1308
            |..|:...:|.:       .:....|.||..|......|.:.| |.||.|:|.....::|.|   
Human   937 QGSETQVLRVQE-------AEAGVWGMSEGKSGAWGAQEAEMK-VLESPENKSGTFKAQEAE--- 990

  Fly  1309 PTVIPASEIEKESKPEDE-KKTEADFAAPTEQPEATTPAQIADTAEKEVDDKLATTSAPVSGEDE 1372
                 |..:..|...|.| ..|||..      ||    ||:|..         |...||.:...|
Human   991 -----AGVLGNEKGKEAEGSLTEASL------PE----AQVASG---------AGAGAPRASSPE 1031

  Fly  1373 LKPADEKKRTETAQIPDAEIPASTDEPESSTELPTVDLDKKPEEDSTKGTEAPESDKVPEVPTSA 1437
              .|:|.:|...:|.|.|.:.:|....|...|:.|          ..:|.      ::....|  
Human  1032 --KAEEDRRLPGSQAPPALVSSSQSLLEWCQEVTT----------GYRGV------RITNFTT-- 1076

  Fly  1438 STENEIEESDKFTTVAPPKISASDETEPTAEEDLVPATFEPIESEFEVSTKKPAVQG-------- 1494
            |..|.:..........|.||..              |:.:|:..:   ...|.|..|        
Human  1077 SWRNGLAFCAILHRFYPDKIDY--------------ASLDPLNIK---QNNKQAFDGFAALGVSR 1124

  Fly  1495 --PPLPTLAPAQPEKKPVDAE--------TSTEADISTEPSAEVEKEASGETSESDNEIDAGASS 1549
              .|...:..:.|:|..|...        |..|..:       |:.|..|           ||.:
Human  1125 LLEPADMVLLSVPDKLIVMTYLCQIRAFCTGQELQL-------VQLEGGG-----------GAGT 1171

  Fly  1550 TPVPVSADEDKTPSTEKTVEADDKFTTVAPLAGDEEESNLPKLPQDIFEEEAPVAVTTAAPSKDD 1614
            ..|                                 .|..|..|.|:   :|............:
Human  1172 YRV---------------------------------GSAQPSPPDDL---DAGGLAQRLRGHGAE 1200

  Fly  1615 GEQKPVEVEEKPIEDGQKPIEDETSTPTSSENEIEPESDRATTIAPSKEEPSEPSTGAPTKDEPA 1679
            |.|:|.|..::  .||..|       ..:|.|.:                     .|..:||..|
Human  1201 GPQEPKEAADR--ADGAAP-------GVASRNAV---------------------AGRASKDGGA 1235

  Fly  1680 EPSTDAPESDESKETP-ESEVPTTVAPAGEKIPTSSITPDEEPTATSAPVAK------PDEDVEK 1737
            |    ||......|.| |..|....||.|..:.....:.:.||.:...|.|.      .|.|:.|
Human  1236 E----APRESRPAEVPAEGLVNGAGAPGGGGVRLRRPSVNGEPGSVPPPRAHGSFSHVRDADLLK 1296

  Fly  1738 E------TSTEIPTDAPASSEEDENSSTDQIPSEVPEKKPETPA--QTPEEGDIVGATAAPTTSD 1794
            :      .|:....|.|.:......::..|.|...|...|.|.|  |.|..|         ::..
Human  1297 KRRSRLRNSSSFSMDDPDAGAMGAAAAEGQAPDPSPAPGPPTAADSQQPPGG---------SSPS 1352

  Fly  1795 EVPPVQRLPEEVLAEIPQPSTETGIKQQDETT--AAPSIDRKEPYVTEIDEEATTV----APISE 1853
            |.||            |.|..|.|:::..:|:  ....:...|....:||..|..|    ..:.|
Human  1353 EEPP------------PSPGEEAGLQRFQDTSQYVCAELQALEQEQRQIDGRAAEVEMQLRSLME 1405

  Fly  1854 KDEKPTEEEKPVEQ 1867
            ......:||..:::
Human  1406 SGANKLQEEVLIQE 1419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tncNP_001247300.1 VWC 235..296 CDD:214564
PHA02664 <433..595 CDD:177447 45/172 (26%)
Ehrlichia_rpt 529..1065 CDD:118064 147/605 (24%)
DUF863 <1684..>1788 CDD:283539 28/119 (24%)
VWC 2762..>2805 CDD:302663
EHBP1L1XP_006718549.1 NT-C2 12..164 CDD:287345 19/100 (19%)
RPA_2b-aaRSs_OBF_like <272..316 CDD:299125 11/45 (24%)
CH 1050..1149 CDD:278723 20/134 (15%)
DUF3585 1371..1511 CDD:288945 9/50 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.