DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nmnat and NMA2

Sequence 1:NP_651315.2 Gene:Nmnat FlyBaseID:FBgn0039254 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_011524.1 Gene:NMA2 SGDID:S000003242 Length:395 Species:Saccharomyces cerevisiae

Alignment Length:263 Identity:100/264 (38%)
Similarity:146/264 (55%) Gaps:27/264 (10%)


  Fly    39 TKSL-----LPRIAFIACGCFSPPTPMHLRMFEIAKDHFEMQGTHRVVGGIISPTHDSYGKKGLA 98
            ||.|     ||.| .:|||.|||.|.:||||||:|.|....|....||||..||..|:|.|:|||
Yeast   149 TKKLQDPEKLPLI-IVACGSFSPITYLHLRMFEMALDDINEQTRFEVVGGYFSPVSDNYQKRGLA 212

  Fly    99 SALDRCAMVKLATQ-SSNWIRLSDWEVHQNQWMRTQAVLQHHQNYINNHINSGGGGGDDGENTHL 162
            .|..|..|.:||.: :|:|:.:..||..|:.:.||..||.|..:.||  |..||....|||    
Yeast   213 PAYHRVRMCELACERTSSWLMVDAWESLQSSYTRTAKVLDHFNHEIN--IKRGGIMTVDGE---- 271

  Fly   163 PGWLPRGLHDSRDPVHLKLLCGADLLESFAVPGLWAEADIEDIVANHGLVVITRAGSNPGKFIFD 227
                       :..|.:.||.|.||:||...|.:||::|:..|:.|:|.:::.|.||:...|:..
Yeast   272 -----------KMGVKIMLLAGGDLIESMGEPHVWADSDLHHILGNYGCLIVERTGSDVRSFLLS 325

  Fly   228 SDILTKYQSNITLITNWVPNEVSSTLIRRLLGRGQSVKYLLDDLVLEYIKRQRLFNFKS---KYI 289
            .||:.:::.||.:|...:.|::|||.:|..:.||.||:|||.:.|:.||:...|:..:|   |.:
Yeast   326 HDIMYEHRRNILIIKQLIYNDISSTKVRLFIRRGMSVQYLLPNSVIRYIQEYNLYINQSEPVKQV 390

  Fly   290 TDA 292
            .|:
Yeast   391 LDS 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NmnatNP_651315.2 NMNAT_Eukarya 46..282 CDD:185681 92/237 (39%)
NMA2NP_011524.1 NMNAT_Eukarya 160..380 CDD:185681 92/238 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C18251770
eggNOG 1 0.900 E1_COG1057
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I1031
Isobase 1 0.950 0 Normalized mean entropy S1288
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001264
OrthoInspector 1 1.000 T634767
orthoMCL 1 0.900 OOG5_128044
Panther 1 1.100 O PTHR12039
Phylome 1 0.910 0.833 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R815
TreeFam 1 0.960
1211.730

Return to query results.
Submit another query.