DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nmnat and NMA1

Sequence 1:NP_651315.2 Gene:Nmnat FlyBaseID:FBgn0039254 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_013432.1 Gene:NMA1 SGDID:S000004320 Length:401 Species:Saccharomyces cerevisiae

Alignment Length:261 Identity:96/262 (37%)
Similarity:143/262 (55%) Gaps:24/262 (9%)


  Fly    23 FKRRSKSKKMSAFIEETKSLLPRIAFIACGCFSPPTPMHLRMFEIAKDHFEMQGTHRVVGGIISP 87
            |.....|||:   ::..|  || :..:|||.|||.|.:||||||:|.|....|....|:||..||
Yeast   149 FPSHRLSKKL---LDPNK--LP-LVIVACGSFSPITYLHLRMFEMALDAISEQTRFEVIGGYYSP 207

  Fly    88 THDSYGKKGLASALDRCAMVKLATQ-SSNWIRLSDWEVHQNQWMRTQAVLQHHQNYINNHINSGG 151
            ..|:|.|:|||.:..|..|.:||.: :|:|:.:..||..|..:.||..||.|..:.||  |..||
Yeast   208 VSDNYQKQGLAPSYHRVRMCELACERTSSWLMVDAWESLQPSYTRTAKVLDHFNHEIN--IKRGG 270

  Fly   152 GGGDDGENTHLPGWLPRGLHDSRDPVHLKLLCGADLLESFAVPGLWAEADIEDIVANHGLVVITR 216
            .....||               :..|.:.||.|.||:||...|.:||:||:..|:.|:|.:::.|
Yeast   271 VATVTGE---------------KIGVKIMLLAGGDLIESMGEPNVWADADLHHILGNYGCLIVER 320

  Fly   217 AGSNPGKFIFDSDILTKYQSNITLITNWVPNEVSSTLIRRLLGRGQSVKYLLDDLVLEYIKRQRL 281
            .||:...|:...||:.:::.||.:|...:.|::|||.:|..:.|..||:|||.:.|:.||:..||
Yeast   321 TGSDVRSFLLSHDIMYEHRRNILIIKQLIYNDISSTKVRLFIRRAMSVQYLLPNSVIRYIQEHRL 385

  Fly   282 F 282
            :
Yeast   386 Y 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NmnatNP_651315.2 NMNAT_Eukarya 46..282 CDD:185681 89/237 (38%)
NMA1NP_013432.1 NMNAT_Eukarya 166..386 CDD:185681 89/237 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C18258984
eggNOG 1 0.900 E1_COG1057
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I1031
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001264
OrthoInspector 1 1.000 T634767
orthoMCL 1 0.900 OOG5_128044
Panther 1 1.100 LDO PTHR12039
Phylome 1 0.910 0.833 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R815
TreeFam 1 0.960
1110.780

Return to query results.
Submit another query.