DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nmnat and NMNAT

Sequence 1:NP_651315.2 Gene:Nmnat FlyBaseID:FBgn0039254 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001190551.1 Gene:NMNAT AraportID:AT5G55810 Length:264 Species:Arabidopsis thaliana

Alignment Length:272 Identity:81/273 (30%)
Similarity:134/273 (49%) Gaps:68/273 (25%)


  Fly    46 IAFIACGCFSPPTPMHLRMFEIAKDHFEMQGTHRVVGGIISPTHDSYGKK---------GLASAL 101
            :..:|.|.|:|||.|||||||:|:|....:|.| |:||.:||.:|:|.||         .:.|.:
plant    22 VVLVATGSFNPPTFMHLRMFELARDELRSKGFH-VLGGYMSPVNDAYKKKIMCRAFYLQNIFSLV 85

  Fly   102 DRCAMVK------------LATQSSNWIRLSDWEVHQNQWMRTQAVLQHHQNYINNHINSGGGGG 154
            ::|.:.|            |.|....:|:                    .|:::||         
plant    86 EQCVVYKNVEAVSTGISKQLPTNFDGFIK--------------------GQDFLNN--------- 121

  Fly   155 DDGENTHLPG-----WLPRGLHDSRD---------PVHLKLLCGADLLESFAVPGLWAEADIEDI 205
               ::|...|     ::.|..|.:.|         .:.:.||||:|||.||..||:|....:..|
plant   122 ---KSTCTRGVACYVFIIRASHYANDKHKFILMLESLKVMLLCGSDLLLSFCTPGVWIPEQLRTI 183

  Fly   206 VANHGLVVITRAGSNPGKFIFDSDILTKYQSNITLITNWVPNEVSSTLIRRLLGRGQSVKYLLDD 270
            ..::|:|.|.|.|.:....|...:||.:..:|:.::.|.|||::||:.:|:.:.||.|||||.:|
plant   184 CKDYGIVCIRREGQDVENMISGDEILNENCANVKIVDNTVPNQISSSRLRQCISRGLSVKYLTED 248

  Fly   271 LVLEYIKRQRLF 282
            .|::||::.:|:
plant   249 GVIDYIRQHQLY 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NmnatNP_651315.2 NMNAT_Eukarya 46..282 CDD:185681 81/271 (30%)
NMNATNP_001190551.1 nt_trans 1..261 CDD:294020 81/273 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1879
OMA 1 1.010
OrthoDB 1 1.010 D1308027at2759
OrthoInspector 1 1.000 T193034
orthoMCL 1 0.900 OOG5_128044
Panther 1 1.100 LDO PTHR12039
Phylome 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.